Lus10036044 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76590 91 / 2e-22 PLATZ transcription factor family protein (.1)
AT1G21000 91 / 4e-22 PLATZ transcription factor family protein (.1.2)
AT2G27930 87 / 4e-21 PLATZ transcription factor family protein (.1)
AT1G32700 86 / 4e-21 PLATZ transcription factor family protein (.1.2)
AT1G43000 84 / 7e-20 PLATZ transcription factor family protein (.1)
AT4G17900 79 / 2e-18 PLATZ transcription factor family protein (.1.2)
AT5G46710 77 / 5e-17 PLATZ transcription factor family protein (.1)
AT1G31040 62 / 2e-11 PLATZ transcription factor family protein (.1)
AT2G12646 62 / 2e-11 PLATZ transcription factor family protein (.1)
AT3G60670 54 / 2e-08 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005350 172 / 9e-54 AT1G21000 151 / 4e-45 PLATZ transcription factor family protein (.1.2)
Lus10035554 105 / 4e-28 AT1G21000 221 / 4e-73 PLATZ transcription factor family protein (.1.2)
Lus10027735 105 / 8e-28 AT1G21000 218 / 9e-72 PLATZ transcription factor family protein (.1.2)
Lus10000952 91 / 6e-22 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2)
Lus10002700 90 / 2e-21 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2)
Lus10040292 88 / 4e-21 AT1G21000 317 / 3e-110 PLATZ transcription factor family protein (.1.2)
Lus10023411 88 / 2e-20 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2)
Lus10030968 87 / 2e-20 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2)
Lus10040082 86 / 2e-20 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G212400 110 / 3e-30 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1)
Potri.009G003200 110 / 5e-30 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1)
Potri.006G119400 109 / 7e-30 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
Potri.016G097100 102 / 7e-27 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2)
Potri.002G002200 93 / 4e-23 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2)
Potri.005G259000 92 / 1e-22 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2)
Potri.003G092800 87 / 6e-21 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2)
Potri.001G141500 87 / 7e-21 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2)
Potri.019G051200 84 / 1e-19 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2)
Potri.013G078500 81 / 2e-18 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Lus10036044 pacid=23141152 polypeptide=Lus10036044 locus=Lus10036044.g ID=Lus10036044.BGIv1.0 annot-version=v1.0
ATGAAATTCTTTATAAGACGCGGAAATTCGAAAAACTTTCACACCTCCTTCAAACCAACATTGAAAAACCGTCGCCGCTGCCGTAATCCTCGCTGGAGCT
CTCCGCCGCCGGATAGCCACCGGACCGCCGCCTCGCCGCCGCCGCGCCGTCGAGGTATCAAATTAAGGCCGACGTGCCGACCGGCCGACGACGGCGTCGG
CAGTCAACGCCGACTGCCAACTCATGTCATTGGAAGTCAACCCCGACCTTCAGGATTGAAAATTAGAAAGTCGTCGTACAACAACGTGGTGAGGGTTTCT
GAGGTAGAAGAGTTGATCGAGCTGAACGGCGTTCAGACTTACGTCATCAACAGTGCCAAGGTAGTGTTCTTGAACGAGCGTCCTTTGACGACCAAAAACG
GCAGCTCCTCGTCGTCATCCTCGTCAGTTAGTGGTGTTGGTGGCGGTTTCAACGGCGCCAGGTCTGTTATGCATTTCTGTCAGATTTGTGGCAGAGGCCT
CTTGGAAGCTTGCCGCTTCTGTTCCTTGGGATGCAAGCTGGCAAGATTCAAAAGGAATGGTGATACAAGCTTCAAGCTTGCGACCCCGAACAACGGAGGC
GAAGAAGACGACGCAATGTATCAATCTCCACTGCCGTAA
AA sequence
>Lus10036044 pacid=23141152 polypeptide=Lus10036044 locus=Lus10036044.g ID=Lus10036044.BGIv1.0 annot-version=v1.0
MKFFIRRGNSKNFHTSFKPTLKNRRRCRNPRWSSPPPDSHRTAASPPPRRRGIKLRPTCRPADDGVGSQRRLPTHVIGSQPRPSGLKIRKSSYNNVVRVS
EVEELIELNGVQTYVINSAKVVFLNERPLTTKNGSSSSSSSSVSGVGGGFNGARSVMHFCQICGRGLLEACRFCSLGCKLARFKRNGDTSFKLATPNNGG
EEDDAMYQSPLP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27930 PLATZ transcription factor fam... Lus10036044 0 1
AT5G47880 ERF1-1 eukaryotic release factor 1-1 ... Lus10031479 1.0 0.9487
Lus10028233 3.3 0.9111
Lus10032535 4.1 0.8736
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 4.5 0.9397
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 5.5 0.9397
Lus10000400 6.3 0.9397
AT1G49230 RING/U-box superfamily protein... Lus10005814 6.8 0.8042
AT1G75490 AP2_ERF DREB2D Integrase-type DNA-binding sup... Lus10006127 6.9 0.7946
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 7.1 0.9397
AT5G18460 Protein of Unknown Function (D... Lus10006860 7.7 0.9397

Lus10036044 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.