Lus10036048 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19390 411 / 6e-141 Rho GTPase activation protein (RhoGAP) with PH domain (.1), Rho GTPase activation protein (RhoGAP) with PH domain (.2), Rho GTPase activation protein (RhoGAP) with PH domain (.3), Rho GTPase activation protein (RhoGAP) with PH domain (.4)
AT5G12150 381 / 2e-128 Rho GTPase activation protein (RhoGAP) with PH domain (.1), Rho GTPase activation protein (RhoGAP) with PH domain (.2)
AT4G24580 349 / 1e-114 REN1 ROP1 ENHANCER 1, Rho GTPase activation protein (RhoGAP) with PH domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036167 330 / 9e-108 AT4G24580 697 / 0.0 ROP1 ENHANCER 1, Rho GTPase activation protein (RhoGAP) with PH domain (.1)
Lus10005733 241 / 3e-79 AT4G24580 350 / 1e-113 ROP1 ENHANCER 1, Rho GTPase activation protein (RhoGAP) with PH domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G069700 436 / 8e-149 AT5G19390 1060 / 0.0 Rho GTPase activation protein (RhoGAP) with PH domain (.1), Rho GTPase activation protein (RhoGAP) with PH domain (.2), Rho GTPase activation protein (RhoGAP) with PH domain (.3), Rho GTPase activation protein (RhoGAP) with PH domain (.4)
Potri.001G275200 426 / 9e-145 AT5G19390 1080 / 0.0 Rho GTPase activation protein (RhoGAP) with PH domain (.1), Rho GTPase activation protein (RhoGAP) with PH domain (.2), Rho GTPase activation protein (RhoGAP) with PH domain (.3), Rho GTPase activation protein (RhoGAP) with PH domain (.4)
Potri.002G104300 369 / 2e-122 AT4G24580 793 / 0.0 ROP1 ENHANCER 1, Rho GTPase activation protein (RhoGAP) with PH domain (.1)
Potri.005G157400 364 / 1e-120 AT4G24580 786 / 0.0 ROP1 ENHANCER 1, Rho GTPase activation protein (RhoGAP) with PH domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0409 GAP PF00620 RhoGAP RhoGAP domain
Representative CDS sequence
>Lus10036048 pacid=23141036 polypeptide=Lus10036048 locus=Lus10036048.g ID=Lus10036048.BGIv1.0 annot-version=v1.0
ATGAACAATGATTTTCTGCAGAGTGCCTTACCACAAAAGGGTGGTGAAGTGAACCTAACATTAGGAGGAATTGATTTAAATAATTCAGGGAGTGTGGTTG
TAAGAGAAGATAAGAAGCTGTTGACTGTTCTATTTCCTGATGGCCGTGATGGACGAGCATTTACACTTAAGGCTGAAACATCAGAAGATTTGTCCGAGTG
GAAGGCGGCCCTTGAGCTTGCCCTTGCACAAGCGCCAAGTGCTGCCCTTGTTATGGGGCATAATGGGATTTTTCGAAGCGACACTAACGATGCAATTGAC
GGGAGGGATAAGCGCCCTGTGAAATCATTAGTTGTTGGAAGACCAATTTTGCTTGCTCTTGAAGATATTGATGGAAGTCCATCTTTTCTTGAGAAAGCTC
TTCGATTTCTTGAAAAATATGGTACTAAAGTAGAGGGAATCCTGAGACAGTCGGCTGATGTTGAGGAGGTCGATAGAAGAGTTCAAGAATATGAGCAAGG
TAAAATTGAATTTGAGCCAGACGAGGATGCTCATGTTGTTGGTGATTGTGTGAAGCATGTTCTGAGGGAGCTTCCTTCCTCCCCAGTTCCAGCATCTTGC
TGTACCGCGTTGTTGGAGGCCTACAAAATTGATCGGAAGGAAACTCGAATAGCGGCTATGCGGTCTGCGATCGTGGAAACATTTCCTGAACCAAACCGGC
GGTTGTTACAGAGGTGA
AA sequence
>Lus10036048 pacid=23141036 polypeptide=Lus10036048 locus=Lus10036048.g ID=Lus10036048.BGIv1.0 annot-version=v1.0
MNNDFLQSALPQKGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLSEWKAALELALAQAPSAALVMGHNGIFRSDTNDAID
GRDKRPVKSLVVGRPILLALEDIDGSPSFLEKALRFLEKYGTKVEGILRQSADVEEVDRRVQEYEQGKIEFEPDEDAHVVGDCVKHVLRELPSSPVPASC
CTALLEAYKIDRKETRIAAMRSAIVETFPEPNRRLLQR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19390 Rho GTPase activation protein ... Lus10036048 0 1
AT3G47890 Ubiquitin carboxyl-terminal hy... Lus10008630 1.4 0.9487
AT1G79570 Protein kinase superfamily pro... Lus10031750 2.4 0.9467
AT4G39850 AtABCD1, ACN2, ... PEROXISOME DEFECTIVE 3, COMATO... Lus10024056 4.2 0.9366
AT2G15900 Phox-associated domain;Phox-li... Lus10012043 5.0 0.9377
AT2G47500 P-loop nucleoside triphosphate... Lus10010302 5.7 0.9255
AT3G60920 unknown protein Lus10009306 6.0 0.9481
AT1G31780 unknown protein Lus10037281 6.3 0.9342
AT5G53480 ARM repeat superfamily protein... Lus10023246 8.8 0.9176
AT1G58350 ZW18 Putative serine esterase fami... Lus10036215 9.4 0.9053
AT2G45540 WD-40 repeat family protein / ... Lus10009307 10.0 0.9383

Lus10036048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.