Lus10036049 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62350 316 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G46870 213 / 4e-69 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G09320 79 / 1e-16 VPS9B Vacuolar sorting protein 9 (VPS9) domain (.1)
AT3G27750 56 / 3e-09 EMB3123 EMBRYO DEFECTIVE 3123, unknown protein
AT1G13040 57 / 4e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G18475 56 / 5e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G42570 52 / 3e-08 peroxidase family protein (.1)
AT5G48730 52 / 8e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G31400 50 / 5e-07 GUN1 genomes uncoupled 1 (.1)
AT1G74850 49 / 1e-06 PDE343, PTAC2 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000892 471 / 3e-171 AT1G62350 318 / 3e-111 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040756 207 / 6e-67 AT3G46870 349 / 2e-122 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016476 205 / 7e-66 AT3G46870 346 / 3e-121 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011849 56 / 7e-09 AT5G48730 681 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011646 53 / 5e-08 AT1G13040 503 / 1e-175 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10022787 53 / 9e-08 AT5G48730 687 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036129 50 / 5e-07 AT1G13040 573 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10017041 50 / 5e-07 AT2G36240 436 / 4e-151 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10037592 49 / 1e-06 AT1G51965 792 / 0.0 ABA Overly-Sensitive 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G275000 369 / 7e-131 AT1G62350 274 / 7e-94 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G038200 203 / 2e-65 AT3G46870 326 / 2e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G134300 103 / 1e-26 AT5G09320 114 / 1e-28 Vacuolar sorting protein 9 (VPS9) domain (.1)
Potri.009G169600 78 / 3e-17 AT5G09320 219 / 8e-67 Vacuolar sorting protein 9 (VPS9) domain (.1)
Potri.002G243600 59 / 6e-10 AT5G48730 691 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G149400 55 / 1e-08 AT2G15980 477 / 4e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G090400 51 / 2e-07 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G051400 49 / 5e-07 AT3G27750 171 / 2e-53 EMBRYO DEFECTIVE 3123, unknown protein
Potri.004G074500 49 / 1e-06 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G111600 48 / 2e-06 AT3G09060 860 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10036049 pacid=23141122 polypeptide=Lus10036049 locus=Lus10036049.g ID=Lus10036049.BGIv1.0 annot-version=v1.0
ATGTCGCGTTTGATGTCCAATTTCGTCCTCCTACTCCGCAACTCCTCGTGGGCTCCACGACTCCTGCTGGCTGAAAACTTCTCTAATTTGGCTTCCAGGA
CGAGGCCGAGCTTGTCGATATGGAGGCGGAAGAAAGAAATGGGGAAAGAAGGCCTTTTTGCTGCTAAGGAGCTGAAACGTCTACAATCAAATCCCTCGCG
CCTCGACCGTTTCATCCATTCCCACGTCTCTCGGCTACTCAAGTCTGATCTCGTAGCTGTGCTAGCTGAGTTCCAGCGCCAAGATCAGGTCTTCCTCTGC
ATGAAGTTATATGACGTGATACGCAAAGAGATATGGTATAAGCCGGACATGTTCTTTTACAGGGACATGCTTATGATGCTTGCAAGGAACAAGAAAGTTG
ATGAAGCAGAACAAGTTTGGCAAGATTTGAAGAGAGAGCAAGTTTTGTTCGATCAGCATACATTCGGGGACATCATGAGAGCCTTTCTGGACAATGGGTT
GCCATCTGAAGCGATGCAGATATATGAGGAAATGAGACAGTCACCTGATCCACCACTGTCTTTGCCCTTCCGAGTGATCTTGAAAGGGCTAATCCCATAT
CCGGAGTTAAGGGAGCAAGTGAAAGATGATTTCTTGGAGCTTTTTCCTAGCATGATTGTCTACGACCCAGCTGAGGATCTGTTTGACGATGAAGAATCTA
AAAGGGAAAGCGACTTTGATTGA
AA sequence
>Lus10036049 pacid=23141122 polypeptide=Lus10036049 locus=Lus10036049.g ID=Lus10036049.BGIv1.0 annot-version=v1.0
MSRLMSNFVLLLRNSSWAPRLLLAENFSNLASRTRPSLSIWRRKKEMGKEGLFAAKELKRLQSNPSRLDRFIHSHVSRLLKSDLVAVLAEFQRQDQVFLC
MKLYDVIRKEIWYKPDMFFYRDMLMMLARNKKVDEAEQVWQDLKREQVLFDQHTFGDIMRAFLDNGLPSEAMQIYEEMRQSPDPPLSLPFRVILKGLIPY
PELREQVKDDFLELFPSMIVYDPAEDLFDDEESKRESDFD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62350 Pentatricopeptide repeat (PPR)... Lus10036049 0 1
AT2G20725 CAAX amino terminal protease f... Lus10039818 2.6 0.7541
AT5G62950 RNA polymerase II, Rpb4, core ... Lus10005329 12.4 0.6823
AT4G19150 Ankyrin repeat family protein ... Lus10001414 13.3 0.7067
AT1G26180 unknown protein Lus10031917 14.7 0.7018
AT3G26115 Pyridoxal-5'-phosphate-depende... Lus10036952 23.5 0.6519
AT5G42520 BBR_BPC BPC6, BBR/BPC6,... ARABIDOPSIS THALIANA BASIC PEN... Lus10012389 24.7 0.6454
AT3G27670 RST1 RESURRECTION1, ARM repeat supe... Lus10013076 27.1 0.6920
AT2G03390 uvrB/uvrC motif-containing pro... Lus10037120 27.3 0.6999
AT5G63040 unknown protein Lus10039957 27.7 0.6974
AT1G55170 unknown protein Lus10041450 36.8 0.6772

Lus10036049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.