Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12240 68 / 9e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026824 [exp] 122 / 2e-37 AT5G12240 47 / 7e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G069000 [exp] 86 / 2e-22 AT5G12240 74 / 5e-18 unknown protein Potri.001G274400 [exp] 85 / 2e-22 AT5G12240 102 / 3e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036054 pacid=23141022 polypeptide=Lus10036054 locus=Lus10036054.g ID=Lus10036054.BGIv1.0 annot-version=v1.0 ATGGATGAAGAGGAATTCCGCCGCCACCTTGAACTCTTTCCCGTCGTCCGTTCCCCAGATTATCATATTGATTCAGACCGATCCAGGCAGTCGAATTCTT CAAGGCGCCCACAGCCTATTGAGAAGGGCAGGGAGTTGCAGGGTGCTCCTGTGGAGCAAGGAGATGAACTGGAATTAGAGGATCAAACTTTTGATACTCG TGATCCTTTCTGGGAGAAGCTTAAGTTGGCTGCAGAAAAGAAGGTTGGTGCAGAGGATGCCAAGAGATTTTGCAAGGCGTTTCAACAAGTTCACAGAAAA CTTGTATGCATGCCAACTACTTCATCTCGAAAGTTGTGA
AA sequence Show only first row Show all	>Lus10036054 pacid=23141022 polypeptide=Lus10036054 locus=Lus10036054.g ID=Lus10036054.BGIv1.0 annot-version=v1.0 MDEEEFRRHLELFPVVRSPDYHIDSDRSRQSNSSRRPQPIEKGRELQGAPVEQGDELELEDQTFDTRDPFWEKLKLAAEKKVGAEDAKRFCKAFQQVHRK LVCMPTTSSRKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12240			unknown protein		Lus10036054 [exp]	0	1
AT2G36900		ATMEMB11, MEMB1...	membrin 11 (.1.2)		Lus10020302 [exp]	9.2	0.7304
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Lus10038818 [exp]	9.7	0.7282
AT1G67620			Lojap-related protein (.1)		Lus10036979 [exp]	39.9	0.7148
AT3G14130			Aldolase-type TIM barrel famil...		Lus10008133 [exp]	50.5	0.6537
AT2G37195			unknown protein		Lus10023187 [exp]	61.8	0.7043
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Lus10019502 [exp]	70.3	0.6514
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10000044 [exp]	74.6	0.6714
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Lus10029939 [exp]	83.9	0.6518
AT1G79660			unknown protein		Lus10041631 [exp]	109.2	0.6419
AT1G23050			hydroxyproline-rich glycoprote...		Lus10043476 [exp]	126.7	0.6455

Compare expression of checked genes

Lus10036054 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.