Lus10036091 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52590 195 / 3e-64 Putative thiol-disulphide oxidoreductase DCC (.1)
AT1G24095 73 / 4e-16 Putative thiol-disulphide oxidoreductase DCC (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030833 77 / 2e-17 AT1G24095 253 / 7e-86 Putative thiol-disulphide oxidoreductase DCC (.1)
Lus10030653 76 / 3e-17 AT1G24095 229 / 2e-77 Putative thiol-disulphide oxidoreductase DCC (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G213200 201 / 2e-66 AT1G52590 222 / 5e-75 Putative thiol-disulphide oxidoreductase DCC (.1)
Potri.008G147000 64 / 1e-12 AT1G24095 216 / 3e-71 Putative thiol-disulphide oxidoreductase DCC (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04134 DUF393 Protein of unknown function, DUF393
Representative CDS sequence
>Lus10036091 pacid=23141056 polypeptide=Lus10036091 locus=Lus10036091.g ID=Lus10036091.BGIv1.0 annot-version=v1.0
ATGGCGCTACTCGCTCCCTGCGGCGGGTCAGTACTGTTTCACCGGCCGTCCACCGTGCAAAACGGAAGCAGATTCACCGCTTTAGCTGCTATATCTCCTT
CTCCTCCTCCAGCAGAAACGGTGAACTGGGTCGAAGCAACCAATAGCTTCTTCGACAATGATTCTCGACCCATCATGCTATTTGACGGAGTTTGCAATCT
TTGCAATGGAGGTGTGAGGTTTGTTCGACAAAACGATCGAAACAGGAGAATTAGGTATGAGGCTCTCCAGAGTGAACAAGGGATGAGACTGCTGAGGAGA
TCAGGGAGAGCTCCAGATGATATTTCAAGTGTTGTTCTTGTTGAAAAGGATAGATCGTATATCAAGTCGGAAGCTGTACTGAAGATAATGGAATACATAG
ACTTGCCTTTCCCACAGTTAGCATTGTTTCTGCAGTTGGTGCCATTGTTCTTAAGAGATTTCGTGTATGACAATGTTGCAAACAATCGTTACAACATATT
TGGTCGCTCAGAATCATGCGAGGTATACTATGATTAA
AA sequence
>Lus10036091 pacid=23141056 polypeptide=Lus10036091 locus=Lus10036091.g ID=Lus10036091.BGIv1.0 annot-version=v1.0
MALLAPCGGSVLFHRPSTVQNGSRFTALAAISPSPPPAETVNWVEATNSFFDNDSRPIMLFDGVCNLCNGGVRFVRQNDRNRRIRYEALQSEQGMRLLRR
SGRAPDDISSVVLVEKDRSYIKSEAVLKIMEYIDLPFPQLALFLQLVPLFLRDFVYDNVANNRYNIFGRSESCEVYYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52590 Putative thiol-disulphide oxid... Lus10036091 0 1
AT2G47400 CP12-1 CP12 domain-containing protein... Lus10001453 4.7 0.9215
AT1G79040 PSBR photosystem II subunit R (.1) Lus10042461 10.6 0.9128
AT5G02120 PDE335, OHP PIGMENT DEFECTIVE 335, one hel... Lus10023782 10.7 0.9066
AT1G66130 NAD(P)-binding Rossmann-fold s... Lus10002180 12.2 0.9116
AT2G30570 PSBW photosystem II reaction center... Lus10024858 12.6 0.9121
AT3G25530 GR1, GLYR1, GHB... glyoxylate reductase 1 (.1.2) Lus10012301 14.2 0.8272
AT3G21870 CYCP2;1 cyclin p2;1 (.1) Lus10039697 15.0 0.9030
AT3G02730 TRXF1, ATF1 thioredoxin F-type 1 (.1) Lus10020199 15.5 0.8952
AT3G10130 SOUL heme-binding family prote... Lus10022712 15.9 0.8799
AT4G09620 Mitochondrial transcription te... Lus10009420 16.5 0.8388

Lus10036091 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.