Lus10036101 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G12110 208 / 8e-68 Glutathione S-transferase, C-terminal-like;Translation elongation factor EF1B/ribosomal protein S6 (.1)
AT2G18110 135 / 3e-39 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
AT1G30230 133 / 1e-38 Glutathione S-transferase, C-terminal-like;Translation elongation factor EF1B/ribosomal protein S6 (.1.2)
AT5G19510 130 / 1e-37 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026784 294 / 8e-102 AT5G12110 297 / 6e-103 Glutathione S-transferase, C-terminal-like;Translation elongation factor EF1B/ribosomal protein S6 (.1)
Lus10037618 137 / 5e-40 AT2G18110 319 / 2e-111 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Lus10013555 134 / 1e-38 AT2G18110 313 / 3e-109 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Lus10017261 131 / 1e-36 AT2G18110 308 / 3e-105 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G094200 172 / 7e-54 AT2G18110 299 / 1e-103 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Potri.012G096400 135 / 2e-39 AT2G18110 275 / 4e-94 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Potri.009G018600 130 / 2e-37 AT2G18110 158 / 3e-48 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Potri.001G224700 127 / 3e-36 AT2G18110 153 / 3e-46 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Representative CDS sequence
>Lus10036101 pacid=23141219 polypeptide=Lus10036101 locus=Lus10036101.g ID=Lus10036101.BGIv1.0 annot-version=v1.0
ATGGCCATCTCATTCTCAGATCTCCACACCGAGGCTGGTCTCAAGGCTCTTGAAGCCTTCCTCTCTGGAAAATCTTACATCTCCGGTGAAAAATTTACTA
AAGACGATGTAAAGGTTTATGCTGCTGTTCAAGGCAAACCCAGCGATTCATTCCCTAATGCCAGCAAGTGGTACAGCGCCGTTTCCTCACATCTTGCTTC
AAGCTTCCCTGGCAAAGCTGTTGGTGTAGCAGTTGGTGGCGCTGTTGCCTCTACCCCTGCGAAAGAGGCTCCTGCTGCTAGTGGTGGAGATGATGATGAT
GACTTGGACCTTTTTGGTGATGAGACTGAGGAGGAGAAGAAGGCTGCAGAGGAGAGGGAGAAAGCTAAGTCTTCCACAAAGAAGAAAGAAAGCGGTAAGT
CTTCCATTGTTTTGGATGTGAAGCCTTGGGATGATGAGACAGACATGAAGAAGTTGGAGGAGGCAGTAAGGAGCATTGAGATGGAGGGTCTCCTGTGGGG
AGCATCAAAATTGGTTACAGTCGGTTATGGCATCAAGAAGCTCCAGATCATGATGACCATAGTGGATGACCTTGTCTCTGTTGACGATCTTGTTGATGAA
TATCTCACTGTTGAGCCACGCAACGAATACATCCAGAGCTGTGACATTGTCGCATTCAACAAAATTTAA
AA sequence
>Lus10036101 pacid=23141219 polypeptide=Lus10036101 locus=Lus10036101.g ID=Lus10036101.BGIv1.0 annot-version=v1.0
MAISFSDLHTEAGLKALEAFLSGKSYISGEKFTKDDVKVYAAVQGKPSDSFPNASKWYSAVSSHLASSFPGKAVGVAVGGAVASTPAKEAPAASGGDDDD
DLDLFGDETEEEKKAAEEREKAKSSTKKKESGKSSIVLDVKPWDDETDMKKLEEAVRSIEMEGLLWGASKLVTVGYGIKKLQIMMTIVDDLVSVDDLVDE
YLTVEPRNEYIQSCDIVAFNKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G12110 Glutathione S-transferase, C-t... Lus10036101 0 1
AT1G26880 Ribosomal protein L34e superfa... Lus10037177 2.2 0.9563
AT5G15200 Ribosomal protein S4 (.1.2) Lus10012839 4.9 0.9442
AT4G18100 Ribosomal protein L32e (.1) Lus10009591 5.5 0.9555
AT1G22780 RPS18A, PFL1, P... 40S RIBOSOMAL PROTEIN S18, POI... Lus10042603 6.2 0.9501
AT5G15200 Ribosomal protein S4 (.1.2) Lus10030487 7.7 0.9361
AT1G60770 Tetratricopeptide repeat (TPR)... Lus10029115 8.0 0.9190
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10031979 8.1 0.9410
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Lus10008873 9.2 0.9440
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10041264 9.2 0.9406
AT5G57290 60S acidic ribosomal protein f... Lus10012714 9.4 0.9372

Lus10036101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.