Lus10036118 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G45280 327 / 2e-113 ATSYP72, SYP72 syntaxin of plants 72 (.1)
AT3G09740 312 / 3e-107 ATSYP71, SYP71 syntaxin of plants 71 (.1)
AT3G61450 285 / 7e-97 ATSYP73, SYP73 syntaxin of plants 73 (.1.2)
AT5G61210 43 / 0.0001 SNP33, ATSNAP33B, SNAP33 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
AT1G13890 42 / 0.0002 ATSNAP30, SNAP30 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019925 328 / 2e-113 AT3G09740 419 / 2e-149 syntaxin of plants 71 (.1)
Lus10023178 320 / 3e-110 AT3G09740 416 / 1e-148 syntaxin of plants 71 (.1)
Lus10026495 320 / 7e-110 AT3G09740 408 / 5e-145 syntaxin of plants 71 (.1)
Lus10015075 311 / 4e-107 AT3G09740 417 / 3e-149 syntaxin of plants 71 (.1)
Lus10036377 298 / 9e-98 AT3G09740 347 / 8e-117 syntaxin of plants 71 (.1)
Lus10014759 267 / 1e-85 AT3G09740 308 / 4e-102 syntaxin of plants 71 (.1)
Lus10007411 75 / 1e-16 AT3G09740 65 / 1e-13 syntaxin of plants 71 (.1)
Lus10026653 50 / 4e-07 AT1G13890 220 / 1e-72 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10037092 49 / 2e-06 AT1G13890 327 / 1e-113 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G129500 334 / 7e-116 AT3G09740 377 / 3e-133 syntaxin of plants 71 (.1)
Potri.016G088200 333 / 1e-115 AT3G09740 384 / 3e-136 syntaxin of plants 71 (.1)
Potri.014G087400 318 / 8e-110 AT3G09740 352 / 2e-123 syntaxin of plants 71 (.1)
Potri.015G049000 44 / 7e-05 AT5G61210 403 / 3e-142 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Potri.012G066700 43 / 0.0001 AT5G61210 360 / 3e-125 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Potri.010G160350 40 / 0.001 AT1G13890 266 / 2e-89 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
Representative CDS sequence
>Lus10036118 pacid=23141027 polypeptide=Lus10036118 locus=Lus10036118.g ID=Lus10036118.BGIv1.0 annot-version=v1.0
ATGAGCGTTATCGACATTATCTTCAGGGTTGATGAGATCTGCAAGAAATATGACAAGTACGACATCGAGAAGCAGCGGGAGCTCAATGCCTACGGGGACG
ATGCCTTCGCTCGCCTTTACGCCACCGTCGAGGCTGAGATTGAAGCCGCTATGGGTAAAGCCGACAGGGCTTCAAAGGAGAGCAAAAGGGCTGTTACCGT
TGCTTTGAATGCCGAAATTCGCAAGACCAAGACTCGGTTGATGGATGAAGTTACCAAACTTCAAAAGTTGGCTCTCAAGAAGGTTAAAGGACTTTCTAAG
GAAGAACAGGCCATTCGTGCTGATCTGGTACTTGCACTACCAGAGAGGATTCAAGCCATACCCGATGGAACCACAGGAGCAGCAAACCAGTCTGGAGGAT
GGGCTGGTTCTGCATCTCATAAGAATATCACATTCGATACGTCAGAAGAAAACCTTAACGATGGTTTTTTCCAACAATCTGAAGAATCTGACCAGTTTAG
GCAGGAGTATGACAGGCGAAAACTTAAACAGGCATGCGAAGATGAAGGTCTTGATGTGATATCAGAGGGGTTGGATACGTTGAAAAATCTGGCCCATGAT
ATGGGTGAGGAGTTGGACAGACAAGTTCCCTTAATGGATGAGATTGACACAAAGGTAGACAAAGCGAATTCCGAGTTGAGAAACACAAATGTCAAACTCA
AGCAAACTCTAACTTCGATGAGATCCAGTCGCAACTTCTGCATTGACATTATCTTGATTTGTGTAATCCTGGGAATTGCTTCCTACATATACAAGTATGT
TCCTTGCGGTCGATCATGCATGTCTCCTTTTATTCAGCTTTTGGATGGATGTTAG
AA sequence
>Lus10036118 pacid=23141027 polypeptide=Lus10036118 locus=Lus10036118.g ID=Lus10036118.BGIv1.0 annot-version=v1.0
MSVIDIIFRVDEICKKYDKYDIEKQRELNAYGDDAFARLYATVEAEIEAAMGKADRASKESKRAVTVALNAEIRKTKTRLMDEVTKLQKLALKKVKGLSK
EEQAIRADLVLALPERIQAIPDGTTGAANQSGGWAGSASHKNITFDTSEENLNDGFFQQSEESDQFRQEYDRRKLKQACEDEGLDVISEGLDTLKNLAHD
MGEELDRQVPLMDEIDTKVDKANSELRNTNVKLKQTLTSMRSSRNFCIDIILICVILGIASYIYKYVPCGRSCMSPFIQLLDGC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45280 ATSYP72, SYP72 syntaxin of plants 72 (.1) Lus10036118 0 1
Lus10018415 1.7 0.8100
AT4G17905 ATL4H RING/U-box superfamily protein... Lus10025338 2.0 0.8180
AT1G17810 BETA-TIP beta-tonoplast intrinsic prote... Lus10040652 7.4 0.8365
AT4G35700 C2H2ZnF DAZ3 DUO1-activated zinc finger 3, ... Lus10041659 16.7 0.7956
AT5G39190 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THA... Lus10033764 17.7 0.7399
AT5G52390 PAR1 protein (.1) Lus10018204 19.7 0.7706
Lus10017959 20.9 0.7517
AT1G07260 UGT71C3 UDP-glucosyl transferase 71C3 ... Lus10010474 22.4 0.6771
AT2G29040 Exostosin family protein (.1) Lus10016532 25.3 0.7502
AT1G79860 ATROPGEF12, ROP... MATERNAL EFFECT EMBRYO ARREST ... Lus10037866 25.8 0.7509

Lus10036118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.