Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60460 84 / 2e-22 Preprotein translocase Sec, Sec61-beta subunit protein (.1) AT2G45070 67 / 8e-16 SEC61 BETA, SEC61BETA SUPPRESSORS OF SECRETION-DEFECTIVE 61 BETA, Preprotein translocase Sec, Sec61-beta subunit protein (.1.2.3.4) AT3G60540 67 / 9e-16 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010009 [exp] 62 / 4e-14 AT3G60540 109 / 3e-33 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10011428 [exp] 62 / 6e-14 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10037570 [exp] 62 / 6e-14 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10025029 [exp] 62 / 8e-14 AT3G60540 107 / 2e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G012000 [exp] 94 / 2e-26 AT5G60460 86 / 6e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1) Potri.002G143100 [exp] 66 / 3e-15 AT3G60540 86 / 1e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Potri.014G059000 [exp] 65 / 3e-15 AT3G60540 81 / 7e-22 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03911 [flax] [poplar] Sec61_beta Sec61beta family
Representative CDS sequence Show only first row Show all	>Lus10036119 pacid=23141101 polypeptide=Lus10036119 locus=Lus10036119.g ID=Lus10036119.BGIv1.0 annot-version=v1.0 ATGGCGAAAGGTTCTTCCCAGTCCCAATCATCCACCTCATCCAGCTCCTCCCGTCCTGGCCCTCCTCGCGGCTCCGTTGCTGCCACCCCCGGATTACGCC GCCGCCGGCTTGGAGGAGCTTCATCATCTCCATCTTCCACTGGTGCATCAGTTGGAGGTGGCGGCGGAAATATGCTCCGATTCTACACTGAAGATGCACC GGGGCTCAAGATCTCCCCCACCGTAGTCCTCGTCATCAGCATCTGCTTCATTGGTTTCGTCACCGCGCTCCATGTTTTCGGAAAGCTCTACAGGAGCAAA CTCTCTCCGACCGGAGCCTAA
AA sequence Show only first row Show all	>Lus10036119 pacid=23141101 polypeptide=Lus10036119 locus=Lus10036119.g ID=Lus10036119.BGIv1.0 annot-version=v1.0 MAKGSSQSQSSTSSSSSRPGPPRGSVAATPGLRRRRLGGASSSPSSTGASVGGGGGNMLRFYTEDAPGLKISPTVVLVISICFIGFVTALHVFGKLYRSK LSPTGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60460			Preprotein translocase Sec, Se...		Lus10036119 [exp]	0	1
AT3G11690			unknown protein		Lus10013608 [exp]	1.4	0.8277
AT2G18050		HIS1-3	histone H1-3 (.1.2)		Lus10025968 [exp]	2.0	0.8354
AT3G20890			RNA-binding (RRM/RBD/RNP motif...		Lus10030140 [exp]	4.6	0.7689
AT1G21410		SKP2A	F-box/RNI-like superfamily pro...		Lus10018942 [exp]	6.0	0.7803
AT4G34630			unknown protein		Lus10028793 [exp]	6.9	0.7966
AT1G21410		SKP2A	F-box/RNI-like superfamily pro...		Lus10028645 [exp]	8.9	0.7966
AT4G17880	bHLH	bHLH004, MYC4	Basic helix-loop-helix (bHLH) ...		Lus10000484 [exp]	12.4	0.7405
AT1G06210			ENTH/VHS/GAT family protein (....		Lus10024896 [exp]	12.6	0.7852
AT5G54470	CO		B-box type zinc finger family ...		Lus10039727 [exp]	15.6	0.7637
AT1G67856			RING/U-box superfamily protein...		Lus10011416 [exp]	19.2	0.7517

Compare expression of checked genes

Lus10036119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.