Lus10036124 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56450 426 / 4e-153 PBG1 20S proteasome beta subunit G1 (.1)
AT5G40580 43 / 7e-05 PBB2 20S proteasome beta subunit PBB2 (.1.2.3)
AT3G27430 43 / 8e-05 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT4G14800 41 / 0.0003 PBD2 20S proteasome beta subunit D2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011640 504 / 0 AT1G56450 427 / 8e-154 20S proteasome beta subunit G1 (.1)
Lus10032102 46 / 1e-05 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10014581 45 / 3e-05 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3)
Lus10021909 40 / 0.001 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G037700 431 / 3e-155 AT1G56450 407 / 5e-146 20S proteasome beta subunit G1 (.1)
Potri.006G242000 425 / 8e-153 AT1G56450 399 / 1e-142 20S proteasome beta subunit G1 (.1)
Potri.006G077900 50 / 2e-07 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.017G071100 46 / 9e-06 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3)
Potri.010G084800 45 / 1e-05 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1)
Potri.008G155500 44 / 3e-05 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1)
Potri.004G066000 44 / 3e-05 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Lus10036124 pacid=23141230 polypeptide=Lus10036124 locus=Lus10036124.g ID=Lus10036124.BGIv1.0 annot-version=v1.0
ATGGAGTCGAATCAAACTAAGCCGAGCCTTCTGGCTTCTGAATCTGACTCCCAACGAACGCTATATCCGTATGTGACTGGTACGTCCGTCGTGGCTTTGA
AGTACAAGGACGGGATTTTGATGGCTGCTGACATGGGAGGTTCATATGGGTCGACCTTGCGTTACAAGAGTGTGGGGCGAATGACGCCTGTTGGGAAGCA
CTCTCTGCTTGGGGCAAGTGGGGAAATCAGTGATTTCCAGGAGATATGCCGATATCTTGATCAGCTGGTCCTAAATGACAACATGTGGGATGATGGGAAC
TCTTTGGGTCCAAAAGAAGTGCACAACTATTTGACTAGAGTTATGTACAATAGGAGGAACAAGTTTGATCCTTTTTGGAATGCGCTTGTTCTTGGTGGAG
TTAAAAATGGTCAGAAGTATCTCGGCATGGTAAACATGATTGGCCTTAATTTTGAGGATGATCATGTTGCGACTGGATTTGGAAATCACCTTGCTCGACC
AATCCTTCGTGACGAGTGGCATGAAAACCTGAGCTTTGAAGATGGTGTTAAGTTGCTGGAGAAATGTATGCGTGTGCTCTTGTACCGTGACAGATCTGCT
GTCAATAAGCTTCAGATAGCTAAGATAACGGAAGAAGGTGTGACAATTTCACAGCCCTACTCATTGAAGACTTTCTGGGGATACGCAGCATTCCAGAATC
CAACTGCAGGTGCGGAGGGATCATGGTAG
AA sequence
>Lus10036124 pacid=23141230 polypeptide=Lus10036124 locus=Lus10036124.g ID=Lus10036124.BGIv1.0 annot-version=v1.0
MESNQTKPSLLASESDSQRTLYPYVTGTSVVALKYKDGILMAADMGGSYGSTLRYKSVGRMTPVGKHSLLGASGEISDFQEICRYLDQLVLNDNMWDDGN
SLGPKEVHNYLTRVMYNRRNKFDPFWNALVLGGVKNGQKYLGMVNMIGLNFEDDHVATGFGNHLARPILRDEWHENLSFEDGVKLLEKCMRVLLYRDRSA
VNKLQIAKITEEGVTISQPYSLKTFWGYAAFQNPTAGAEGSW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10036124 0 1
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10031085 1.4 0.9210
AT3G22110 PAC1 20S proteasome alpha subunit C... Lus10004235 1.4 0.9399
AT4G24820 26S proteasome, regulatory sub... Lus10014916 4.2 0.9169
AT4G26210 Mitochondrial ATP synthase sub... Lus10001771 11.0 0.9148
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10020599 12.7 0.8254
AT5G17250 Alkaline-phosphatase-like fami... Lus10006806 13.2 0.8807
AT5G35620 eIFiso4E, EIF(I... LOSS OF SUSCEPTIBILITY TO POTY... Lus10023733 14.7 0.9026
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10011640 14.9 0.8142
AT5G57290 60S acidic ribosomal protein f... Lus10012714 15.3 0.9101
AT1G26880 Ribosomal protein L34e superfa... Lus10037177 15.5 0.9124

Lus10036124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.