Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11340 52 / 7e-09 S-locus lectin protein kinase family protein (.1) AT1G11410 46 / 1e-06 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030767 [exp] 151 / 1e-43 AT1G11340 670 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013246 [exp] 135 / 3e-38 AT1G11340 678 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013244 [exp] 130 / 3e-36 AT1G11340 669 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013245 [exp] 129 / 7e-36 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10034637 [exp] 125 / 2e-34 AT1G11340 660 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013247 [exp] 123 / 3e-34 AT1G11340 402 / 4e-131 S-locus lectin protein kinase family protein (.1) Lus10030766 [exp] 117 / 7e-32 AT1G11340 660 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10025512 [exp] 115 / 7e-31 AT1G11340 530 / 5e-177 S-locus lectin protein kinase family protein (.1) Lus10030768 [exp] 110 / 3e-29 AT1G11340 667 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G036532 [exp] 76 / 2e-17 AT1G11340 247 / 6e-75 S-locus lectin protein kinase family protein (.1) Potri.011G036400 [exp] 73 / 3e-16 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035901 [exp] 70 / 8e-16 AT1G11340 171 / 8e-49 S-locus lectin protein kinase family protein (.1) Potri.004G028300 [exp] 71 / 2e-15 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036600 [exp] 68 / 2e-14 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035700 [exp] 66 / 2e-13 AT1G11340 743 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036100 [exp] 65 / 2e-13 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035800 [exp] 64 / 7e-13 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035600 [exp] 50 / 2e-08 AT4G21380 711 / 0.0 receptor kinase 3 (.1) Potri.004G028701 [exp] 49 / 1e-07 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036139 pacid=23141268 polypeptide=Lus10036139 locus=Lus10036139.g ID=Lus10036139.BGIv1.0 annot-version=v1.0 ATGGTCTACAAACGTTTCCAGAACTTTTCCCTGTTCAGCTCCACTATTGGATTCAGGAAATCTGGTGTTGGTCCAACAAGATCAGAAGATGATCCCGGAA CTGGCGATTTCTCGTTTAAGATCAATCTGAACGGCTCGCCTCAGTTCCTTTTGTATCAGGGGATGAATCCCAGTAGGCAGGGTGTCCTATGGGCATGGAA AGTAGAGCATCATTTGTACAATGGTTCTTTTGTTAATAATGAAGTTGGGATATGGTACTCGTTTGTTCCTCGTGATGCTTCAACTGTGTTGATGCTTGTG ATTGACAATTTGGGAACAGCGAGAACAGTAATGTAG
AA sequence Show only first row Show all	>Lus10036139 pacid=23141268 polypeptide=Lus10036139 locus=Lus10036139.g ID=Lus10036139.BGIv1.0 annot-version=v1.0 MVYKRFQNFSLFSSTIGFRKSGVGPTRSEDDPGTGDFSFKINLNGSPQFLLYQGMNPSRQGVLWAWKVEHHLYNGSFVNNEVGIWYSFVPRDASTVLMLV IDNLGTARTVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11340			S-locus lectin protein kinase ...		Lus10036139 [exp]	0	1
AT2G27410	B3		Domain of unknown function (DU...		Lus10027284 [exp]	1.0	0.9952
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	2.4	0.9930
					Lus10015828 [exp]	3.5	0.9911
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10029872 [exp]	3.9	0.9890
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	4.5	0.9894
AT2G03200			Eukaryotic aspartyl protease f...		Lus10022917 [exp]	5.3	0.9841
AT5G15430			Plant calmodulin-binding prote...		Lus10000141 [exp]	5.5	0.9887
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002933 [exp]	6.0	0.9781
AT5G48140			Pectin lyase-like superfamily ...		Lus10013780 [exp]	6.2	0.9622
					Lus10019410 [exp]	6.3	0.9739

Compare expression of checked genes

Lus10036139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.