Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07870 46 / 8e-07 Protein kinase superfamily protein (.1.2) AT1G07860 45 / 9e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G093700 [exp] 64 / 2e-13 AT1G07860 67 / 7e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036143 pacid=23140997 polypeptide=Lus10036143 locus=Lus10036143.g ID=Lus10036143.BGIv1.0 annot-version=v1.0 ATGATGCAGCAAAGACAGACCACCTCCACTAGAGCACCATCCACTCACCATCAGTATCACACGATCAATGTGCCGGATGACGATCTGAACCAGCACCGGC CAAACGTCTTAAGAACTGCAAGCTCCTCGTCCTACTGCTGGATCCATCTAATTCCTATGGTCGTCCTCATCTCCCTCTTTCTTCTCTGGTGGTTCTCTCG TGCAGTAAGCCTGGAGATGAAGGATGGTGAAATAGTGGGAATACATCCGATCAACTTTGAGGAAGTACGTTTCAAGGGCAATATGGTTGAGCTTGCGGTC TGGGAATTTGTTGCTCCCAAAGGGTCTATTCCTTTCAACATTACACCATATTGA
AA sequence Show only first row Show all	>Lus10036143 pacid=23140997 polypeptide=Lus10036143 locus=Lus10036143.g ID=Lus10036143.BGIv1.0 annot-version=v1.0 MMQQRQTTSTRAPSTHHQYHTINVPDDDLNQHRPNVLRTASSSSYCWIHLIPMVVLISLFLLWWFSRAVSLEMKDGEIVGIHPINFEEVRFKGNMVELAV WEFVAPKGSIPFNITPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07860			unknown protein		Lus10036143 [exp]	0	1
AT4G37770		ACS8	1-amino-cyclopropane-1-carboxy...		Lus10011565 [exp]	5.7	0.8112
AT5G25910		AtRLP52	receptor like protein 52 (.1)		Lus10016112 [exp]	6.3	0.7614
AT5G52390			PAR1 protein (.1)		Lus10033988 [exp]	8.7	0.6913
					Lus10005747 [exp]	10.9	0.7821
AT5G20480		EFR	EF-TU receptor (.1)		Lus10026938 [exp]	11.1	0.7616
					Lus10027448 [exp]	13.6	0.7607
AT1G68040			S-adenosyl-L-methionine-depend...		Lus10007950 [exp]	14.7	0.7135
AT4G37770		ACS8	1-amino-cyclopropane-1-carboxy...		Lus10039647 [exp]	17.9	0.7525
					Lus10005748 [exp]	20.5	0.7034
AT4G29680			Alkaline-phosphatase-like fami...		Lus10017872 [exp]	24.7	0.7107

Compare expression of checked genes

Lus10036143 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.