Lus10036171 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20930 62 / 2e-12 TSL TOUSLED, Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G155400 86 / 1e-20 AT5G20930 914 / 0.0 TOUSLED, Protein kinase superfamily protein (.1)
Potri.004G193300 84 / 6e-20 AT5G20930 886 / 0.0 TOUSLED, Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10036171 pacid=23141099 polypeptide=Lus10036171 locus=Lus10036171.g ID=Lus10036171.BGIv1.0 annot-version=v1.0
ATGTCAGATGATATGTTGATACATTTCTCTTCCAACTCTTCAAATCAATCGGACCAGTCCTTGCCGACTAAAATCGCCAAGCTGGAAGCTCGTTTGGTTG
GCAAGACTCCTTCTGCTGCACCATCAACCCAGCAATCTCAACAGCAGCAACAGCAACAGCCAGCCTGGTCGTCGTTTCCTTTAGGTGCAAAATTTGGTGC
TGCCGATGAATTAGCAGGTTCCAGTGATTCTGATGATGATAATGAAGAAGAGTTTCTCATACAGGCAAACACACAGAAGAGGCAAAGACTACAAGAAGAT
GATAATTCATCTGTTAAGGCACCGCTTGAGGTATATTATTCTGTCTGTGCTTTCCATCTGGGTTGA
AA sequence
>Lus10036171 pacid=23141099 polypeptide=Lus10036171 locus=Lus10036171.g ID=Lus10036171.BGIv1.0 annot-version=v1.0
MSDDMLIHFSSNSSNQSDQSLPTKIAKLEARLVGKTPSAAPSTQQSQQQQQQQPAWSSFPLGAKFGAADELAGSSDSDDDNEEEFLIQANTQKRQRLQED
DNSSVKAPLEVYYSVCAFHLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20930 TSL TOUSLED, Protein kinase superf... Lus10036171 0 1
AT1G07670 ATECA4 endomembrane-type CA-ATPase 4 ... Lus10042843 2.4 0.9390
AT2G35630 GEM1, MOR1 MICROTUBULE ORGANIZATION 1, AR... Lus10001216 3.7 0.9610
AT5G07740 actin binding (.1) Lus10015724 7.7 0.9303
AT1G58250 SAB SABRE, Golgi-body localisation... Lus10024283 10.8 0.9416
AT1G60070 Adaptor protein complex AP-1, ... Lus10030848 12.8 0.9277
AT5G15680 ARM repeat superfamily protein... Lus10031961 14.1 0.9353
AT5G23630 PDR2, MIA PI DEFICIENCY RESPONSE 2, MALE... Lus10020724 14.1 0.9320
AT3G08960 ARM repeat superfamily protein... Lus10004753 16.6 0.9291
AT4G00800 SETH5 transducin family protein / WD... Lus10002679 17.5 0.9292
AT5G10470 KAC1, KCA1 KINESIN CDKA;1 ASSOCIATED 1, k... Lus10035941 19.1 0.9334

Lus10036171 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.