Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31335 67 / 9e-17 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038328 [exp] 140 / 1e-45 AT1G31335 64 / 2e-15 unknown protein Lus10040642 [exp] 57 / 1e-12 AT1G31335 44 / 1e-07 unknown protein Lus10018270 [exp] 57 / 3e-11 AT2G40540 652 / 0.0 potassium transporter 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G148100 [exp] 89 / 4e-25 AT1G31335 37 / 8e-05 unknown protein Potri.001G082332 [exp] 85 / 1e-23 AT1G31335 / unknown protein Potri.006G127000 [exp] 39 / 1e-05 AT1G31335 41 / 2e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036190 pacid=23169453 polypeptide=Lus10036190 locus=Lus10036190.g ID=Lus10036190.BGIv1.0 annot-version=v1.0 ATGGGGATGGTAGTGGTGATATCGTTGCCCTTCATACTGTTCTCGGTTCTGCTGGGAGTTGGATGCTACTACTTCGGACGATACAAAGGCAGGCAGGACA TTCGCACCAATCCACAAGTGTTCGGAGTGCCTACGCCTCCTCCTGCAGCTGCCTTGAACAAATCTCCTCATATTTCTTCAGCTGATGATCATGTTAAGCC AACTGCAGCTGACAATTTGTCCAATATTGTCTGA
AA sequence Show only first row Show all	>Lus10036190 pacid=23169453 polypeptide=Lus10036190 locus=Lus10036190.g ID=Lus10036190.BGIv1.0 annot-version=v1.0 MGMVVVISLPFILFSVLLGVGCYYFGRYKGRQDIRTNPQVFGVPTPPPAAALNKSPHISSADDHVKPTAADNLSNIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31335			unknown protein		Lus10036190 [exp]	0	1
AT1G31335			unknown protein		Lus10038328 [exp]	1.4	0.9305
AT4G17240			unknown protein		Lus10039062 [exp]	3.5	0.9131
AT5G16250			unknown protein		Lus10026857 [exp]	6.3	0.9248
AT5G50890			alpha/beta-Hydrolases superfam...		Lus10020755 [exp]	7.1	0.9121
AT5G38300			unknown protein		Lus10017608 [exp]	13.6	0.8417
AT4G15830			ARM repeat superfamily protein...		Lus10043416 [exp]	15.5	0.9122
AT4G15140			unknown protein		Lus10010477 [exp]	17.1	0.9072
AT5G07670			RNI-like superfamily protein (...		Lus10031742 [exp]	22.1	0.9040
AT3G07800			Thymidine kinase (.1)		Lus10012347 [exp]	24.4	0.8912
AT1G23790			Plant protein of unknown funct...		Lus10013006 [exp]	25.1	0.8755

Compare expression of checked genes

Lus10036190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.