Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45190 110 / 4e-30 Cyclin family protein (.1.2) AT4G19600 106 / 1e-28 CYCT1;4 Cyclin family protein (.1) AT1G27630 75 / 1e-17 CYCT1;3 cyclin T 1;3 (.1) AT4G19560 74 / 3e-17 CYCT1;2 Cyclin family protein (.1) AT1G35440 62 / 5e-13 CYCT1;1 cyclin T1;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040640 [exp] 134 / 7e-39 AT5G45190 587 / 0.0 Cyclin family protein (.1.2) Lus10021927 [exp] 61 / 2e-12 AT5G45190 246 / 2e-75 Cyclin family protein (.1.2) Lus10041213 [exp] 59 / 6e-12 AT5G45190 173 / 4e-49 Cyclin family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G081600 [exp] 131 / 1e-37 AT5G45190 636 / 0.0 Cyclin family protein (.1.2) Potri.003G148800 [exp] 125 / 2e-35 AT5G45190 635 / 0.0 Cyclin family protein (.1.2) Potri.007G067100 [exp] 112 / 2e-30 AT5G45190 564 / 0.0 Cyclin family protein (.1.2) Potri.005G097400 [exp] 102 / 3e-27 AT5G45190 550 / 0.0 Cyclin family protein (.1.2) Potri.002G032300 [exp] 71 / 4e-16 AT5G45190 333 / 6e-109 Cyclin family protein (.1.2) Potri.008G150500 [exp] 61 / 1e-12 AT4G19600 229 / 4e-70 Cyclin family protein (.1) Potri.010G090400 [exp] 61 / 1e-12 AT4G19600 171 / 1e-48 Cyclin family protein (.1) Potri.008G043600 [exp] 40 / 3e-05 AT2G26430 475 / 1e-166 arginine-rich cyclin 1 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036191 pacid=23169320 polypeptide=Lus10036191 locus=Lus10036191.g ID=Lus10036191.BGIv1.0 annot-version=v1.0 ATGACGGGCTTATTGCACGGGGAATCTTCAAATCATGGTGCTTCTGAGAGTGGGACTTCGAGAACCTCTCAGGACAGGCCAGAGGAAGGAGCTGGTTGGT ATTTTACAAGGAAGGAGATAGAAGAAAATTCCCCATCGAGGATAGATGGCATTGACTTGAAGAAAGAGACGTATTTACGCAAGTCATATTGCACATTTTT GCAAGATCTTGGCATGAAGCTTAAAGTGTGA
AA sequence Show only first row Show all	>Lus10036191 pacid=23169320 polypeptide=Lus10036191 locus=Lus10036191.g ID=Lus10036191.BGIv1.0 annot-version=v1.0 MTGLLHGESSNHGASESGTSRTSQDRPEEGAGWYFTRKEIEENSPSRIDGIDLKKETYLRKSYCTFLQDLGMKLKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45190			Cyclin family protein (.1.2)		Lus10036191 [exp]	0	1
AT2G25970			KH domain-containing protein (...		Lus10004445 [exp]	1.4	0.8504
AT1G29940		NRPA2	nuclear RNA polymerase A2 (.1)		Lus10026157 [exp]	12.2	0.8650
AT1G51350			ARM repeat superfamily protein...		Lus10002562 [exp]	13.2	0.8474
AT1G79280		AtTPR, NUA	TRANSLOCATED PROMOTER REGION, ...		Lus10030142 [exp]	16.0	0.8497
AT3G52140			tetratricopeptide repeat (TPR)...		Lus10015708 [exp]	21.6	0.8480
AT1G55930			CBS domain-containing protein ...		Lus10004777 [exp]	22.7	0.8474
AT2G27100	C2H2ZnF	SE	C2H2 zinc-finger protein SERRA...		Lus10026766 [exp]	24.2	0.8304
AT1G48490			Protein kinase superfamily pro...		Lus10031906 [exp]	26.5	0.8379
AT4G39680			SAP domain-containing protein ...		Lus10019680 [exp]	28.2	0.8289
AT5G57990		UBP23	ubiquitin-specific protease 23...		Lus10035825 [exp]	28.3	0.8496

Compare expression of checked genes

Lus10036191 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.