Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43000 222 / 6e-72 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1) AT3G12910 221 / 3e-71 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G39820 191 / 2e-59 NAC ANAC094 NAC domain containing protein 94 (.1) AT1G26870 186 / 3e-56 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G02450 165 / 1e-48 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT1G69490 156 / 2e-46 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT5G08790 155 / 6e-46 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G04070 156 / 1e-45 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G61110 155 / 3e-45 NAC ANAC025 NAC domain containing protein 25 (.1) AT5G63790 154 / 3e-45 NAC ANAC102 NAC domain containing protein 102 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038332 [exp] 416 / 4e-148 AT2G43000 231 / 1e-75 NAC domain containing protein 42 (.1) Lus10031189 [exp] 236 / 2e-76 AT3G12910 264 / 9e-87 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10031767 [exp] 209 / 1e-67 AT2G43000 236 / 3e-78 NAC domain containing protein 42 (.1) Lus10030478 [exp] 200 / 1e-61 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1) Lus10015367 [exp] 197 / 4e-61 AT1G26870 298 / 8e-99 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10036749 [exp] 198 / 2e-60 AT1G26870 306 / 4e-100 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10037178 [exp] 196 / 2e-59 AT5G39820 306 / 3e-101 NAC domain containing protein 94 (.1) Lus10007263 [exp] 192 / 2e-59 AT5G39820 300 / 3e-100 NAC domain containing protein 94 (.1) Lus10030446 [exp] 164 / 2e-49 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G149700 [exp] 257 / 2e-85 AT2G43000 245 / 2e-80 NAC domain containing protein 42 (.1) Potri.001G080900 [exp] 251 / 5e-83 AT2G43000 257 / 3e-85 NAC domain containing protein 42 (.1) Potri.005G098000 [exp] 243 / 7e-80 AT3G12910 271 / 2e-90 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.007G066300 [exp] 239 / 3e-78 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.002G057200 [exp] 230 / 9e-75 AT2G43000 282 / 4e-95 NAC domain containing protein 42 (.1) Potri.005G205400 [exp] 227 / 2e-73 AT2G43000 269 / 6e-90 NAC domain containing protein 42 (.1) Potri.004G126901 [exp] 205 / 9e-64 AT5G39820 305 / 1e-101 NAC domain containing protein 94 (.1) Potri.017G082000 [exp] 201 / 3e-62 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.003G046700 [exp] 161 / 5e-47 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.011G123500 [exp] 157 / 7e-46 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10036194 pacid=23169308 polypeptide=Lus10036194 locus=Lus10036194.g ID=Lus10036194.BGIv1.0 annot-version=v1.0 ATGGAGGACGAGAAGCTGAAGCTGATGATGATGAAGAGGAGAAACGGTGCCGTTTCGGTGGACGACGACGTTTCACTTCCGGGGTTTCGGTTTCATCCGA CCGACGAGGAGCTTGTCGGATTCTATCTGAGGAGGAAGGTGGAGAAGAAGGCTTTGAAGATGGACATCATCAAACTTTGCGACGTCTACAAGTACCAACC ATGGGAACTCCCAAGGGGAGGAGAAGGGGAAAGGGAGATGTACTACTTTTGCAGGAGAGGGAGGAAGTACAAGAACAGCGTCAGGCCCAACAGGGTGACG ACAGCTGGCTGCGGATTCTGGAAAGCCACCGGAATCGACAAGTCCATTTATTCCGGCGGAGGAGGAGATCGTGTCGTCGTCGGCCTTAAGAAATCACTAG TTTACTATCGTGGCAGCGCCGGAAAAGGCACCAAAACCGACTGGATGATGCACGAGTTTCGTCTCCCTCCCAGCAATGGCTATGAAGCAGAAGTTTGGAC ACTATGTCGCATATTCAAGCGAGAAGCTTCGTGCAGAAAGTATGCAGCCACGGTACAGAAGCGGCCGGTGAGTTACCGGAAGCGGTCGGCGGCGGTGGAG AATCATGGCTATTATAATTCAAGCAATGATATGGTGCCCGTTGGACAGCTGATGGCGATGGACTTCAAGTGTTTTCCGAACGGAAGCAGCTGTAGTAATG GAGAGCAATATGAAGCAGAAGAGAGTTTGGAAGAAGGGAAGTGGGATGAGCTTAGGCCAATGGTCGATTTTGCCCTCCTCGATCATCATCATCACCATTC CATCTTCTTCACCTAG
AA sequence Show only first row Show all	>Lus10036194 pacid=23169308 polypeptide=Lus10036194 locus=Lus10036194.g ID=Lus10036194.BGIv1.0 annot-version=v1.0 MEDEKLKLMMMKRRNGAVSVDDDVSLPGFRFHPTDEELVGFYLRRKVEKKALKMDIIKLCDVYKYQPWELPRGGEGEREMYYFCRRGRKYKNSVRPNRVT TAGCGFWKATGIDKSIYSGGGGDRVVVGLKKSLVYYRGSAGKGTKTDWMMHEFRLPPSNGYEAEVWTLCRIFKREASCRKYAATVQKRPVSYRKRSAAVE NHGYYNSSNDMVPVGQLMAMDFKCFPNGSSCSNGEQYEAEESLEEGKWDELRPMVDFALLDHHHHHSIFFT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10036194 [exp]	0	1
AT4G21120		CAT1, AAT1	CATIONIC AMINO ACID TRANSPORTE...		Lus10023271 [exp]	1.0	0.9744
AT1G29860	WRKY	ATWRKY71, WRKY7...	WRKY DNA-binding protein 71 (....		Lus10004537 [exp]	5.5	0.9581
AT5G39150			RmlC-like cupins superfamily p...		Lus10033767 [exp]	6.3	0.9569
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10019457 [exp]	10.0	0.9495
AT5G42500			Disease resistance-responsive ...		Lus10032939 [exp]	10.9	0.9252
AT4G08850			Leucine-rich repeat receptor-l...		Lus10008712 [exp]	14.1	0.9336
AT1G60690			NAD(P)-linked oxidoreductase s...		Lus10023701 [exp]	14.4	0.9664
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10041644 [exp]	14.5	0.9521
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10022191 [exp]	15.3	0.9589
AT4G23690			Disease resistance-responsive ...		Lus10032331 [exp]	16.0	0.9602

Compare expression of checked genes

Lus10036194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.