Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45160 235 / 6e-74 Root hair defective 3 GTP-binding protein (RHD3) (.1) AT3G13870 220 / 1e-68 GOM8, RHD3 GOLGI MUTANT 8, Root hair defective 3 GTP-binding protein (RHD3) (.1), Root hair defective 3 GTP-binding protein (RHD3) (.2) AT1G72960 214 / 1e-66 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036195 [exp] 268 / 2e-86 AT5G45160 1216 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10038333 [exp] 264 / 1e-84 AT5G45160 1217 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10018282 [exp] 249 / 4e-80 AT5G45160 1055 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10040630 [exp] 247 / 1e-78 AT5G45160 1221 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10037641 [exp] 174 / 2e-51 AT1G72960 1108 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10015623 [exp] 109 / 1e-28 AT1G72970 777 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G112700 [exp] 236 / 3e-74 AT5G45160 1161 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.001G201000 [exp] 218 / 1e-67 AT1G72960 1204 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.003G038900 [exp] 212 / 2e-65 AT3G13870 1220 / 0.0 GOLGI MUTANT 8, Root hair defective 3 GTP-binding protein (RHD3) (.1), Root hair defective 3 GTP-binding protein (RHD3) (.2) Potri.012G116210 [exp] 189 / 2e-57 AT5G45160 719 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116700 [exp] 188 / 3e-57 AT5G45160 727 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G117300 [exp] 187 / 3e-57 AT5G45160 620 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116130 [exp] 187 / 1e-56 AT5G45160 707 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G117001 [exp] 166 / 1e-53 AT5G45160 242 / 1e-75 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.015G112600 [exp] 176 / 2e-52 AT5G45160 717 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116000 [exp] 168 / 1e-49 AT5G45160 671 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF05879 [flax] [poplar] RHD3 Root hair defective 3 GTP-binding protein (RHD3)
Representative CDS sequence Show only first row Show all	>Lus10036197 pacid=23169402 polypeptide=Lus10036197 locus=Lus10036197.g ID=Lus10036197.BGIv1.0 annot-version=v1.0 ATGGCTGATGACTGCTGCTCCACGCAACTGATTGACGGCGACGGCACATTCAATGTCGAAGGACTCGATCGCTTCGTCTCTATCACCAAGCTCTCCGACT GCGGTCTCTCCTACGCTGTTGTCGCTATCATGGGTCCTCAAAGCAGCGGCAAGAGTACATTGATGAATCATCTGTTCCATACCAATTTCAGGGAAATGGA TGCCTTCAGGGGAAGGGGTCAAACAACTAAAGGCATTTGGATGGCCAAGTGCGTTGGCATTGAGCCATTTACGCTTGGCATGGATCTAGAAGGAACTGAT GGCAGGGAAAGAGGAGAGGATGATACTACTTTCGAGAAACAAAGTGCACTTTTTGCTTTGGCTGTAGCTGATATTGTGATTATAAACATGTAA
AA sequence Show only first row Show all	>Lus10036197 pacid=23169402 polypeptide=Lus10036197 locus=Lus10036197.g ID=Lus10036197.BGIv1.0 annot-version=v1.0 MADDCCSTQLIDGDGTFNVEGLDRFVSITKLSDCGLSYAVVAIMGPQSSGKSTLMNHLFHTNFREMDAFRGRGQTTKGIWMAKCVGIEPFTLGMDLEGTD GRERGEDDTTFEKQSALFALAVADIVIINM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45160			Root hair defective 3 GTP-bind...		Lus10036197 [exp]	0	1
AT1G79570			Protein kinase superfamily pro...		Lus10031750 [exp]	1.7	0.9460
AT5G53480			ARM repeat superfamily protein...		Lus10023246 [exp]	6.3	0.9004
AT2G15900			Phox-associated domain;Phox-li...		Lus10012043 [exp]	6.9	0.9085
AT5G56250		HAP8	hapless 8 (.1.2)		Lus10027098 [exp]	12.0	0.8807
AT5G45160			Root hair defective 3 GTP-bind...		Lus10038333 [exp]	16.0	0.8514
AT2G28520		VHA-A1	vacuolar proton ATPase A1 (.1)		Lus10036133 [exp]	18.3	0.8880
AT5G42220			Ubiquitin-like superfamily pro...		Lus10034563 [exp]	18.5	0.9063
AT1G58350		ZW18	Putative serine esterase fami...		Lus10036215 [exp]	19.7	0.8722
AT1G59610		DRP2B, CF1, ADL...	Dynamin related protein 2B, dy...		Lus10030357 [exp]	21.0	0.8793
AT4G29380		AtVPS15	Arabidopsis thaliana vacuolar ...		Lus10011135 [exp]	21.9	0.8939

Compare expression of checked genes

Lus10036197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.