Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45130 216 / 7e-73 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT4G19640 210 / 3e-70 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT3G54840 144 / 3e-44 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT1G07410 117 / 1e-33 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT5G59150 115 / 8e-33 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT3G46830 115 / 1e-32 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT1G06400 112 / 8e-32 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT1G09630 112 / 8e-32 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT5G45750 112 / 2e-31 AtRABA1c RAB GTPase homolog A1C (.1) AT1G16920 112 / 2e-31 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036196 [exp] 232 / 5e-80 AT5G45130 214 / 2e-72 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10038334 [exp] 225 / 3e-76 AT5G45130 349 / 3e-124 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10018285 [exp] 217 / 6e-73 AT5G45130 359 / 3e-128 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10040625 [exp] 216 / 8e-73 AT5G45130 355 / 6e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10034903 [exp] 172 / 3e-55 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10028820 [exp] 146 / 7e-45 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10017462 [exp] 147 / 8e-44 AT3G54840 349 / 1e-121 Ras-related small GTP-binding family protein (.1.2) Lus10016486 [exp] 119 / 3e-34 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040745 [exp] 119 / 3e-34 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G117800 [exp] 211 / 2e-70 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.015G113000 [exp] 209 / 9e-70 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 181 / 5e-59 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.003G054900 [exp] 174 / 5e-56 AT4G19640 270 / 4e-93 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Potri.008G035800 [exp] 145 / 1e-44 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.010G226300 [exp] 144 / 2e-44 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.010G197200 [exp] 119 / 2e-34 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 118 / 6e-34 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 118 / 6e-34 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 116 / 2e-33 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10036198 pacid=23169433 polypeptide=Lus10036198 locus=Lus10036198.g ID=Lus10036198.BGIv1.0 annot-version=v1.0 ATGGACAGCGCGGGTAACAAGAACATCAACGCCAAATTGGTGCTCCTCGGTGATCCTGGTGCTGGAAAGTCTAGTCTTGTTCTGCGATTTGTCAAAAACC AGTTTGTTGAGTTTCAGGAATCAACAATAGGGGCTGCCTTCTTTTCACAAACATTGGCAGTGACTGATGTCACTGTAAAATTTGAGATCTGGGACACAGC TGGGCAAGAGAGATATCACAGCCTTGCTCCTATGTACTATCGAGGAGCTGCTGCAGCAATTATCGTGTATGACATCACAAATTCGGCCTCATTTGATCGG GCAAAGAAATGGGTACAAGAACTGCAAGCCCAAGCAACAAGACTCCCACGAGTTCAGCCAGCACAGAACCCGTCTACAATGAATCTCACGGATAGACCTG CAGATCGGGCAGCTATCGCAACTTGCTGTACTTCGTAA
AA sequence Show only first row Show all	>Lus10036198 pacid=23169433 polypeptide=Lus10036198 locus=Lus10036198.g ID=Lus10036198.BGIv1.0 annot-version=v1.0 MDSAGNKNINAKLVLLGDPGAGKSSLVLRFVKNQFVEFQESTIGAAFFSQTLAVTDVTVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITNSASFDR AKKWVQELQAQATRLPRVQPAQNPSTMNLTDRPADRAAIATCCTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19640		ATRAB-F2B, ARA7...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10036198 [exp]	0	1
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10036196 [exp]	1.4	0.9408
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10038334 [exp]	2.8	0.9253
AT2G02960			RING/FYVE/PHD zinc finger supe...		Lus10036754 [exp]	5.9	0.8700
AT2G19830		VPS32, SNF7.2	SNF7 family protein (.1)		Lus10032705 [exp]	10.4	0.8750
AT1G21780			BTB/POZ domain-containing prot...		Lus10029677 [exp]	13.4	0.8626
AT3G51630		ATWNK5, ZIK1, W...	with no lysine (K) kinase 5 (....		Lus10022747 [exp]	13.7	0.8508
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Lus10017489 [exp]	14.0	0.8852
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Lus10017487 [exp]	17.3	0.8759
AT5G41990		EIP1, ATWNK8, W...	EMF1-Interacting Protein 1, wi...		Lus10003215 [exp]	18.1	0.8791
AT1G27980		DPL1, ATDPL1	dihydrosphingosine phosphate l...		Lus10003129 [exp]	32.9	0.8669

Compare expression of checked genes

Lus10036198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.