Lus10036205 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27530 179 / 2e-54 Pectin lyase-like superfamily protein (.1)
AT5G44830 175 / 4e-54 Pectin lyase-like superfamily protein (.1)
AT4G35670 173 / 6e-53 Pectin lyase-like superfamily protein (.1)
AT5G44840 169 / 2e-51 Pectin lyase-like superfamily protein (.1)
AT4G32380 162 / 4e-49 Pectin lyase-like superfamily protein (.1)
AT5G17200 162 / 2e-48 Pectin lyase-like superfamily protein (.1)
AT4G32375 159 / 6e-47 Pectin lyase-like superfamily protein (.1)
AT3G15720 152 / 3e-44 Pectin lyase-like superfamily protein (.1.2)
AT4G32370 140 / 9e-41 Pectin lyase-like superfamily protein (.1)
AT1G80140 137 / 9e-40 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018302 202 / 7e-66 AT5G17200 242 / 3e-78 Pectin lyase-like superfamily protein (.1)
Lus10040604 202 / 1e-64 AT3G15720 249 / 1e-79 Pectin lyase-like superfamily protein (.1.2)
Lus10002727 199 / 5e-63 AT3G15720 254 / 9e-81 Pectin lyase-like superfamily protein (.1.2)
Lus10040610 195 / 1e-60 AT5G17200 346 / 7e-116 Pectin lyase-like superfamily protein (.1)
Lus10016940 193 / 4e-60 AT5G17200 320 / 6e-106 Pectin lyase-like superfamily protein (.1)
Lus10014826 190 / 2e-58 AT5G17200 301 / 1e-97 Pectin lyase-like superfamily protein (.1)
Lus10032875 162 / 3e-48 AT3G15720 342 / 3e-114 Pectin lyase-like superfamily protein (.1.2)
Lus10019711 148 / 1e-42 AT3G07970 461 / 1e-160 QUARTET 2, Pectin lyase-like superfamily protein (.1)
Lus10029511 146 / 1e-41 AT3G07970 480 / 1e-167 QUARTET 2, Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G119700 204 / 6e-65 AT5G17200 356 / 1e-120 Pectin lyase-like superfamily protein (.1)
Potri.018G028700 184 / 1e-56 AT5G27530 362 / 2e-121 Pectin lyase-like superfamily protein (.1)
Potri.015G088600 160 / 7e-48 AT1G70500 323 / 1e-106 Pectin lyase-like superfamily protein (.1)
Potri.006G252900 156 / 3e-46 AT5G44840 297 / 3e-98 Pectin lyase-like superfamily protein (.1)
Potri.001G463000 144 / 4e-41 AT1G23460 634 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.008G211900 143 / 9e-41 AT1G23460 638 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.009G060400 142 / 1e-40 AT3G07970 514 / 0.0 QUARTET 2, Pectin lyase-like superfamily protein (.1)
Potri.017G006700 140 / 2e-40 AT2G43890 591 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.016G054800 141 / 3e-40 AT2G41850 421 / 7e-145 ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE 2, polygalacturonase abscission zone A. thaliana (.1)
Potri.011G159000 140 / 1e-39 AT1G23460 667 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10036205 pacid=23169414 polypeptide=Lus10036205 locus=Lus10036205.g ID=Lus10036205.BGIv1.0 annot-version=v1.0
ATGCAAGTCTCCAACACTTCATTTTCAGTGGCGCCTGACGAAAGCCCCAACACTGACGGGATCGAAATCTCCCATTCCTCCCATGTTCGAATCTACGACT
CCTTCATTGGAACAGGCGACGACTGCATTGCCGTCAATGGCTTCTCGTCTGACGTCAACATTACCCACATCAGCTGTGGCCCTGGTCATGGCATTAGTAT
CGGAAGCTTGGGGAAGAATGGAGCCTACGAGACCGTGGAAGATATCCGTGTTACGGACTCCACGTTCACTCGAACTCAGAACTGTGCTAGAATCAAGACC
TGGAAGGGAGGAAAAGGGTATGTGAGGAAGGTCACCTTTGAGAGGATCACACTCGTTGAGGCACGAAACCCAATCATCATCGACCAGAACTATATGAGTC
GTCATTATGTTCCTGCAGAACCCTCATCAGATGTTGACATCAGTGACGTTCTGTACCGTGAGGTGCATGGATCTACTACTGACAAGAAAGCTGTCCCTTC
TTCTGTGGGCAACGGTGCAGCAACATTGTTGTGGAGAACGTTAACATAA
AA sequence
>Lus10036205 pacid=23169414 polypeptide=Lus10036205 locus=Lus10036205.g ID=Lus10036205.BGIv1.0 annot-version=v1.0
MQVSNTSFSVAPDESPNTDGIEISHSSHVRIYDSFIGTGDDCIAVNGFSSDVNITHISCGPGHGISIGSLGKNGAYETVEDIRVTDSTFTRTQNCARIKT
WKGGKGYVRKVTFERITLVEARNPIIIDQNYMSRHYVPAEPSSDVDISDVLYREVHGSTTDKKAVPSSVGNGAATLLWRTLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27530 Pectin lyase-like superfamily ... Lus10036205 0 1
AT2G33050 AtRLP26 receptor like protein 26 (.1) Lus10019693 1.7 0.8724
AT1G11270 F-box and associated interacti... Lus10025893 3.2 0.8698
AT3G15200 Tetratricopeptide repeat (TPR)... Lus10031269 4.9 0.8493
AT1G66930 Protein kinase superfamily pro... Lus10008362 4.9 0.8640
AT5G16020 GEX3 gamete-expressed 3 (.1) Lus10034090 6.7 0.8579
AT4G02260 AT-RSH1, RSH1, ... RELA-SPOT HOMOLOG 1, RELA/SPOT... Lus10008756 7.8 0.8024
AT5G66460 MAN7, AtMAN7 endo-beta-mannase 7, Glycosyl ... Lus10007210 8.8 0.8437
AT4G27280 Calcium-binding EF-hand family... Lus10039724 9.2 0.8418
AT2G45910 U-box domain-containing protei... Lus10036363 9.5 0.8462
AT3G56400 WRKY ATWRKY70, WRKY7... ARABIDOPSIS THALIANA WRKY DNA-... Lus10029021 11.7 0.8603

Lus10036205 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.