Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19830 259 / 7e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G13410 72 / 2e-15 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G26555 64 / 1e-12 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G60370 59 / 1e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48570 59 / 2e-10 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 57 / 4e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G10060 56 / 8e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G18170 54 / 4e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 54 / 9e-09 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT5G05420 51 / 2e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038345 [exp] 287 / 7e-100 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040937 [exp] 80 / 2e-18 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10009828 [exp] 79 / 4e-18 AT5G13410 314 / 1e-108 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031700 [exp] 66 / 6e-13 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2) Lus10027129 [exp] 62 / 7e-12 AT4G26555 246 / 5e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10015029 [exp] 59 / 1e-10 AT4G25340 331 / 8e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10031121 [exp] 59 / 2e-10 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10032895 [exp] 57 / 6e-10 AT4G26550 338 / 8e-116 Got1/Sft2-like vescicle transport protein family (.1) Lus10038954 [exp] 56 / 8e-10 AT1G18170 193 / 1e-61 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G119800 [exp] 268 / 4e-92 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G068300 [exp] 68 / 4e-14 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G467100 [exp] 67 / 6e-14 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G129200 [exp] 61 / 5e-11 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.014G045600 [exp] 58 / 2e-10 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.016G096600 [exp] 57 / 5e-10 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 57 / 6e-10 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.002G248300 [exp] 56 / 3e-09 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.014G149400 [exp] 55 / 5e-09 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.017G017500 [exp] 52 / 2e-08 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10036206 pacid=23169374 polypeptide=Lus10036206 locus=Lus10036206.g ID=Lus10036206.BGIv1.0 annot-version=v1.0 ATGCAACTCCGACTGAACAATGTCGCTCCTCTCTGCACATCCACACCACCAACTGCCGCTGCCGACACTGCAAAATCGTTACTATCAGTAACCAGCAATT CCGGTGGCGTGAAGGCCTTGGACCTCCGCGTCGGTACCGGCGCAGTTCCCATCGACGGCGACCAGGTGGCGATACATTACTACGGAAGGCTGGGAGCGAA GCAAGGATGGCGATTTGACTCCACTTATGATCACAAGGACGCTAACGGGGAGCCGATTCCTTTTATTTTCATTCTCGGTTCTGGAAAAGTAATTTCAGGG ATTGAATCGGCTGTTAAATCAATGAAACTAGGAGGAATTCGTCGGATCGTAATTCCACCCTCCCAAGGCTATCAGAACACCTCGCAAGAACCTTTACCCC CTAATTTCTTTGACAGGCAGAGGCTGTTCACCACAATCTTCAACCCGACCCGCCTTGCCAATGGAGAAGGATCTACACTAGGAACACTCATCTTCGACAT TGAGCTTGTCGGCCTGAGGAATTAG
AA sequence Show only first row Show all	>Lus10036206 pacid=23169374 polypeptide=Lus10036206 locus=Lus10036206.g ID=Lus10036206.BGIv1.0 annot-version=v1.0 MQLRLNNVAPLCTSTPPTAAADTAKSLLSVTSNSGGVKALDLRVGTGAVPIDGDQVAIHYYGRLGAKQGWRFDSTYDHKDANGEPIPFIFILGSGKVISG IESAVKSMKLGGIRRIVIPPSQGYQNTSQEPLPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVGLRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19830			FKBP-like peptidyl-prolyl cis-...		Lus10036206 [exp]	0	1
AT3G19340			Protein of unknown function (D...		Lus10035127 [exp]	3.5	0.8654
AT2G21370		XK1, XK-1	XYLULOSE KINASE 1, xylulose ki...		Lus10017967 [exp]	6.1	0.8710
AT5G47860			Protein of unknown function (D...		Lus10024193 [exp]	9.8	0.8215
AT4G24470	GATA	GATA25, TIFY1, ...	Zinc-finger protein expressed ...		Lus10042865 [exp]	11.2	0.8197
AT1G64430			Pentatricopeptide repeat (PPR)...		Lus10003876 [exp]	13.5	0.8566
AT5G16500			Protein kinase superfamily pro...		Lus10020383 [exp]	18.0	0.8279
AT1G54350		ABCD2	ATP-binding cassette D2, ABC t...		Lus10001839 [exp]	21.4	0.8478
AT1G21640		ATNADK2, NADK2,...	NAD kinase 2 (.1.2)		Lus10000856 [exp]	23.5	0.8275
AT1G53250			unknown protein		Lus10028136 [exp]	23.6	0.8413
AT4G10000			Thioredoxin family protein (.1...		Lus10009466 [exp]	26.1	0.7890

Compare expression of checked genes

Lus10036206 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.