Lus10036207 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45040 188 / 8e-62 CYTC6A cytochrome c6A, Cytochrome c (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038346 256 / 6e-89 AT5G45040 164 / 2e-52 cytochrome c6A, Cytochrome c (.1)
Lus10036206 45 / 2e-06 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G121101 207 / 4e-69 AT5G45040 209 / 3e-69 cytochrome c6A, Cytochrome c (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0318 Cytochrome-c PF00034 Cytochrom_C Cytochrome c
Representative CDS sequence
>Lus10036207 pacid=23169451 polypeptide=Lus10036207 locus=Lus10036207.g ID=Lus10036207.BGIv1.0 annot-version=v1.0
ATGCGGTTCAGGCAGGTGCCTCGATTCCCGAAGGAGACGACGAAGATAAATATGCTAACTAGCTTCGCTCCTCCGATCATTGCTGCAATCGTCGCTTTGT
CTACCGTCGATGCCGAACCCGTGTCGGCAGCGGCAGTTGGTGGTGTGGATGTGCAGAGAGGAGCGACATTGTTCAGTCGGAGTTGCATCGGCTGTCACGA
CGGAGGAGGCAACATCATTAAACCGGGCGCATCACTCTTTACAGACGATTTAAAAAGAAATGGAGTAGAAACTGAAGATGCCATCTATCAAATTACCTAC
TCCGGCAAGGGAAGAATGCCGGGATTTGGGGAGACTTGCAGTCCAAGAGGGCAGTGCACATTTGGGCCTCGTTTGAAGGATGAAGAGATTAAGGTGTTGG
CCCAGTTCGTAAAGTCACAGGCTGAGCAAGGTTGGCCCAACACCTTCCTTCCTAACGAGTAA
AA sequence
>Lus10036207 pacid=23169451 polypeptide=Lus10036207 locus=Lus10036207.g ID=Lus10036207.BGIv1.0 annot-version=v1.0
MRFRQVPRFPKETTKINMLTSFAPPIIAAIVALSTVDAEPVSAAAVGGVDVQRGATLFSRSCIGCHDGGGNIIKPGASLFTDDLKRNGVETEDAIYQITY
SGKGRMPGFGETCSPRGQCTFGPRLKDEEIKVLAQFVKSQAEQGWPNTFLPNE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45040 CYTC6A cytochrome c6A, Cytochrome c (... Lus10036207 0 1
AT3G15360 ATHM4, ATM4, TR... ARABIDOPSIS THIOREDOXIN M-TYPE... Lus10042784 2.6 0.9485
AT5G62840 Phosphoglycerate mutase family... Lus10007865 2.8 0.9476
AT3G15360 ATHM4, ATM4, TR... ARABIDOPSIS THIOREDOXIN M-TYPE... Lus10029755 5.5 0.9435
AT3G15810 Protein of unknown function (D... Lus10016666 6.1 0.9076
AT3G05625 Tetratricopeptide repeat (TPR)... Lus10015207 6.9 0.9267
AT3G26060 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin s... Lus10034892 7.7 0.9272
AT4G01150 unknown protein Lus10012645 8.7 0.9388
AT3G46780 PTAC16 plastid transcriptionally acti... Lus10040768 9.6 0.9419
AT4G13220 unknown protein Lus10011887 12.7 0.9116
AT1G51110 Plastid-lipid associated prote... Lus10010444 15.9 0.9270

Lus10036207 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.