Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53710 70 / 1e-15 AGD6 ARF-GAP domain 6 (.1.2) AT2G37550 69 / 2e-15 ASP1, AGD7 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012991 [exp] 79 / 1e-20 AT3G53710 103 / 5e-27 ARF-GAP domain 6 (.1.2) Lus10023766 [exp] 83 / 3e-20 AT2G37550 485 / 4e-170 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10023765 [exp] 80 / 3e-19 AT2G37550 507 / 4e-178 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10003978 [exp] 76 / 1e-17 AT2G37550 516 / 0.0 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10038317 [exp] 58 / 6e-12 AT2G37550 166 / 5e-50 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10029174 [exp] 49 / 3e-08 AT3G53710 83 / 1e-18 ARF-GAP domain 6 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G084000 [exp] 74 / 3e-17 AT3G53710 498 / 8e-175 ARF-GAP domain 6 (.1.2) Potri.016G095100 [exp] 74 / 4e-17 AT3G53710 462 / 9e-161 ARF-GAP domain 6 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036211 pacid=23169321 polypeptide=Lus10036211 locus=Lus10036211.g ID=Lus10036211.BGIv1.0 annot-version=v1.0 ATGATGGAGGTTGGTGGCAACGAAAACCTCAACGCCTTCTTATCAGAGCGAGGGATCCCTAAGGAGACCGACATCGTCGCCAAGTACAACACCAAGGCTG CCGCAACTTACAGCGACCGGATCCAGGCTTTGCCCGAAGGGTGCCAGGGCATGATCCTCCTCCCATCACAAATGAAACCATTGATGGAAGTAACGGCCAA AGGCCTATGGATAATAGTGGATCTTCTGATGGCATGA
AA sequence Show only first row Show all	>Lus10036211 pacid=23169321 polypeptide=Lus10036211 locus=Lus10036211.g ID=Lus10036211.BGIv1.0 annot-version=v1.0 MMEVGGNENLNAFLSERGIPKETDIVAKYNTKAAATYSDRIQALPEGCQGMILLPSQMKPLMEVTAKGLWIIVDLLMA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10036211 [exp]	0	1
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Lus10040063 [exp]	3.5	0.8091
AT5G38260			Protein kinase superfamily pro...		Lus10025492 [exp]	7.1	0.7329
AT4G34950			Major facilitator superfamily ...		Lus10010805 [exp]	10.6	0.7323
AT1G05170			Galactosyltransferase family p...		Lus10001148 [exp]	13.4	0.7448
					Lus10020933 [exp]	15.1	0.7036
AT3G28630			Protein of unknown function (D...		Lus10001124 [exp]	19.2	0.6953
					Lus10030316 [exp]	21.7	0.7153
AT3G49070			Protein of unknown function (D...		Lus10027501 [exp]	28.8	0.6737
AT1G13810			Restriction endonuclease, type...		Lus10033589 [exp]	34.7	0.6909
AT5G24090		ATCHIA	chitinase A (.1)		Lus10023534 [exp]	46.6	0.6622

Compare expression of checked genes

Lus10036211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.