Lus10036226 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31040 158 / 2e-48 PLATZ transcription factor family protein (.1)
AT2G12646 127 / 2e-36 PLATZ transcription factor family protein (.1)
AT3G60670 123 / 7e-35 PLATZ transcription factor family protein (.1)
AT2G27930 89 / 3e-22 PLATZ transcription factor family protein (.1)
AT1G21000 87 / 6e-21 PLATZ transcription factor family protein (.1.2)
AT1G43000 86 / 8e-21 PLATZ transcription factor family protein (.1)
AT2G01818 86 / 2e-20 PLATZ transcription factor family protein (.1)
AT1G32700 84 / 2e-20 PLATZ transcription factor family protein (.1.2)
AT1G76590 84 / 7e-20 PLATZ transcription factor family protein (.1)
AT4G17900 81 / 3e-19 PLATZ transcription factor family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038365 216 / 1e-71 AT1G31040 142 / 9e-42 PLATZ transcription factor family protein (.1)
Lus10009283 127 / 2e-36 AT3G60670 249 / 2e-83 PLATZ transcription factor family protein (.1)
Lus10015881 126 / 5e-36 AT3G60670 251 / 4e-84 PLATZ transcription factor family protein (.1)
Lus10008814 127 / 6e-36 AT2G12646 301 / 4e-103 PLATZ transcription factor family protein (.1)
Lus10008031 126 / 1e-35 AT2G12646 294 / 1e-100 PLATZ transcription factor family protein (.1)
Lus10039989 125 / 6e-35 AT2G12646 292 / 3e-99 PLATZ transcription factor family protein (.1)
Lus10038103 120 / 1e-33 AT2G12646 289 / 1e-98 PLATZ transcription factor family protein (.1)
Lus10004577 91 / 2e-22 AT4G17900 287 / 6e-99 PLATZ transcription factor family protein (.1.2)
Lus10000482 90 / 7e-22 AT4G17900 284 / 2e-97 PLATZ transcription factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G159200 169 / 1e-52 AT1G31040 294 / 3e-101 PLATZ transcription factor family protein (.1)
Potri.003G075600 167 / 8e-52 AT1G31040 306 / 1e-105 PLATZ transcription factor family protein (.1)
Potri.006G060500 134 / 5e-39 AT2G12646 321 / 1e-111 PLATZ transcription factor family protein (.1)
Potri.018G116000 130 / 8e-38 AT2G12646 318 / 2e-110 PLATZ transcription factor family protein (.1)
Potri.014G059300 124 / 4e-35 AT3G60670 238 / 6e-79 PLATZ transcription factor family protein (.1)
Potri.002G144900 116 / 5e-32 AT3G60670 250 / 7e-84 PLATZ transcription factor family protein (.1)
Potri.008G137300 103 / 1e-27 AT2G01818 221 / 5e-73 PLATZ transcription factor family protein (.1)
Potri.006G119400 92 / 2e-23 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
Potri.010G103500 94 / 4e-23 AT2G01818 217 / 1e-70 PLATZ transcription factor family protein (.1)
Potri.016G097100 91 / 1e-22 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Lus10036226 pacid=23169333 polypeptide=Lus10036226 locus=Lus10036226.g ID=Lus10036226.BGIv1.0 annot-version=v1.0
ATGGAGAGGAGGAAGAACGAGAAGAACGTATTCTGCTTGCTCTGCTGCCTCACAATTTGCCCTCACTGTTTCCCATCTCACCCTTCCCACCCTCTACTCC
AGGTGAGGAGATATGTGTACCATGACGTGGTTCGACTCGAAGATCTCGAAAAGCTAATCGATTGCTCCTATATTCAGCCGTACACAATAAACAGTGCAAA
GGTGATATTTCTGAAGCAAAGACCACAGTCAAGGTCTGGCAAGGCCGCCTCCTCTGCCAGCTTCTGTTCCACTTGTGACAGAATGCTCCAGCACCCTTTC
CACTTCTGCTCCCTCGCTTGCAAGGTGGAACGCATGGCGGAGGAAGGGGAGAACATGGGTTGCATTCCTTTGATGGGAGGCAGCGAATCGGAGGACATGA
TGATGATGACTAGTAGTAGTAGTGCTGCATTCTCCGGGTTCGACGATGAAGGCGGTGGTGGGCATCTCGAGCCGTCTTATAATTACGATATGGCGGGAGA
AGCGGAGACGTCGGGATCGGGTGACGGTGAGAGGCAAAGGAGGGAGGAAGGAAAAGGAGAAAGAAGAAGAAGAAAGAGGCGGCGGGGTTGA
AA sequence
>Lus10036226 pacid=23169333 polypeptide=Lus10036226 locus=Lus10036226.g ID=Lus10036226.BGIv1.0 annot-version=v1.0
MERRKNEKNVFCLLCCLTICPHCFPSHPSHPLLQVRRYVYHDVVRLEDLEKLIDCSYIQPYTINSAKVIFLKQRPQSRSGKAASSASFCSTCDRMLQHPF
HFCSLACKVERMAEEGENMGCIPLMGGSESEDMMMMTSSSSAAFSGFDDEGGGGHLEPSYNYDMAGEAETSGSGDGERQRREEGKGERRRRKRRRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31040 PLATZ transcription factor fam... Lus10036226 0 1
AT1G32420 F-box and associated interacti... Lus10018969 1.0 0.9035
AT5G56590 O-Glycosyl hydrolases family 1... Lus10012937 4.2 0.8879
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10039303 6.0 0.8874
AT3G22520 unknown protein Lus10041202 7.3 0.8950
AT2G05760 Xanthine/uracil permease famil... Lus10035311 10.6 0.8818
AT5G22410 RHS18 root hair specific 18 (.1) Lus10043010 12.0 0.8682
AT1G22260 AtZYP1a, ZYP1a Myosin heavy chain-related pro... Lus10036517 15.5 0.8845
AT2G22840 GRF ATGRF1 growth-regulating factor 1 (.1... Lus10019275 18.3 0.8837
AT5G59190 subtilase family protein (.1) Lus10009867 19.0 0.8816
AT5G45380 ATDUR3 DEGRADATION OF UREA 3, solute:... Lus10003564 20.4 0.8158

Lus10036226 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.