Lus10036228 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70190 194 / 6e-63 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
AT4G36420 90 / 2e-22 Ribosomal protein L12 family protein (.1)
AT4G37660 77 / 1e-17 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT3G06040 75 / 1e-16 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
AT2G03130 71 / 6e-16 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT3G27850 44 / 1e-05 RPL12-C ribosomal protein L12-C (.1)
AT3G27830 44 / 2e-05 RPL12-A ribosomal protein L12-A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038367 280 / 2e-96 AT1G70190 243 / 3e-82 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10028336 94 / 5e-24 AT4G36420 176 / 1e-56 Ribosomal protein L12 family protein (.1)
Lus10041783 91 / 7e-23 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1)
Lus10031756 88 / 2e-21 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10023839 87 / 3e-21 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10000093 87 / 3e-21 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10031180 86 / 2e-20 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10021011 82 / 3e-19 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10013078 50 / 2e-07 AT3G27830 175 / 7e-56 ribosomal protein L12-A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G074800 207 / 7e-68 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Potri.007G019100 93 / 1e-23 AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1)
Potri.015G077200 87 / 4e-21 AT3G06040 132 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Potri.004G224300 83 / 1e-19 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Potri.001G346100 46 / 4e-06 AT3G27830 146 / 1e-44 ribosomal protein L12-A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
Representative CDS sequence
>Lus10036228 pacid=23169395 polypeptide=Lus10036228 locus=Lus10036228.g ID=Lus10036228.BGIv1.0 annot-version=v1.0
ATGAGTTTGGTTCTAAGATTGCGACATCGCTTGCAAAATAGCTTGTATGCAAAATCAGCCCTTCCACTCTTGAATCAGACAAGCATCTTCAATGGTGTTC
CATCTCGTAGCCTTGCACAAGCTGCTATGAAAGAAGAAGAGGAAGAAGAAGTAGAAATTGATCAGAGGCGGCTCCCAGCAGACTACGACCCCGCAACATT
CGATCCCACCGAGCACCGTAGCCCTCCCACGGAGCGAGTTTTCAGGCTAGTTGACGAGGTTGCCAATCTGACATTAATGGAGGTGGCAGAGCTGGGTTCG
ATTATAATGAAAAGGAAAGGAATGACTGAACCGCCAGTTGTGGGAGTTATCAAGGGCGGAGTAGCTGCTGGGATGGCAATGCAGAAGGGAGGAGGATCGG
GTTCGGCCAAGGAAGAGAAGAAGCCAGAGAAGACGGTTTTCGAGCTGAAGTTGGAGTCTTATGAGGCGGCTTCGAAGATTAAGATCATTAAGGAAGTGAG
GAGCTTTACTGACTTGGGACTTAAGGAAGCGAAGGATCTGGTGGAGAAGACTCCGTCGGTGTTGAAATCGGGCGTATCGAAGGAGGAAGGCGAGAAGATT
ATCGAGAAGTTGAAAGCTTTAGGTGCTAAAGTTGTGTTGGAATGA
AA sequence
>Lus10036228 pacid=23169395 polypeptide=Lus10036228 locus=Lus10036228.g ID=Lus10036228.BGIv1.0 annot-version=v1.0
MSLVLRLRHRLQNSLYAKSALPLLNQTSIFNGVPSRSLAQAAMKEEEEEEVEIDQRRLPADYDPATFDPTEHRSPPTERVFRLVDEVANLTLMEVAELGS
IIMKRKGMTEPPVVGVIKGGVAAGMAMQKGGGSGSAKEEKKPEKTVFELKLESYEAASKIKIIKEVRSFTDLGLKEAKDLVEKTPSVLKSGVSKEEGEKI
IEKLKALGAKVVLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70190 Ribosomal protein L7/L12, olig... Lus10036228 0 1
AT1G08460 HDA8, HDA08, AT... histone deacetylase 8 (.1) Lus10001850 12.7 0.9072
AT2G45570 CYP76C2 "cytochrome P450, family 76, s... Lus10027426 19.3 0.9015
AT5G63040 unknown protein Lus10027687 20.5 0.8688
AT2G19740 Ribosomal protein L31e family ... Lus10038272 21.4 0.8398
AT2G43870 Pectin lyase-like superfamily ... Lus10002124 21.4 0.8908
AT2G24280 alpha/beta-Hydrolases superfam... Lus10021325 28.1 0.8226
AT4G35200 Arabidopsis protein of unknown... Lus10003332 36.1 0.8713
AT3G60050 Pentatricopeptide repeat (PPR)... Lus10014983 44.3 0.8418
AT2G44380 Cysteine/Histidine-rich C1 dom... Lus10003919 45.3 0.8794
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10011052 47.5 0.8781

Lus10036228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.