Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026485 [exp] 40 / 1e-05 AT1G09080 124 / 2e-36 binding protein 3, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2) Lus10022375 [exp] 38 / 6e-05 AT5G28540 767 / 0.0 heat shock protein 70 (Hsp 70) family protein (.1) Lus10007778 [exp] 38 / 7e-05 AT5G42020 318 / 5e-104 luminal binding protein, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2) Lus10015483 [exp] 37 / 0.0002 AT5G28540 758 / 0.0 heat shock protein 70 (Hsp 70) family protein (.1) Lus10017022 [exp] 36 / 0.0003 AT5G42020 986 / 0.0 luminal binding protein, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2) Lus10021345 [exp] 35 / 0.0006 AT5G28540 843 / 0.0 heat shock protein 70 (Hsp 70) family protein (.1) Lus10023016 [exp] 35 / 0.0007 AT5G28540 246 / 9e-77 heat shock protein 70 (Hsp 70) family protein (.1) Lus10029103 [exp] 35 / 0.0007 AT5G28540 615 / 0.0 heat shock protein 70 (Hsp 70) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G018000 [exp] 38 / 5e-05 AT5G28540 991 / 0.0 heat shock protein 70 (Hsp 70) family protein (.1) Potri.012G017600 [exp] 35 / 0.0006 AT5G28540 1093 / 0.0 heat shock protein 70 (Hsp 70) family protein (.1) Potri.001G087500 [exp] 35 / 0.0007 AT5G42020 1184 / 0.0 luminal binding protein, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2) Potri.003G143600 [exp] 35 / 0.0007 AT5G42020 1205 / 0.0 luminal binding protein, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0108 [flax] [poplar] Actin_ATPase PF00012 [flax] [poplar] HSP70 Hsp70 protein
Representative CDS sequence Show only first row Show all	>Lus10036235 pacid=23169379 polypeptide=Lus10036235 locus=Lus10036235.g ID=Lus10036235.BGIv1.0 annot-version=v1.0 ATGTTAACAGAGTTATTCGATGGGAAAGAGCCCAACAATGGAGTGAATCCTGATGAAGCTGTGGCTTACGGTGCTGCTGTTCTTGCTGCCAAACTTGGTT GTCAACCTGATTCTGCTCAGCATGGAGGGGATGAGCTTTATTTCACATAA
AA sequence Show only first row Show all	>Lus10036235 pacid=23169379 polypeptide=Lus10036235 locus=Lus10036235.g ID=Lus10036235.BGIv1.0 annot-version=v1.0 MLTELFDGKEPNNGVNPDEAVAYGAAVLAAKLGCQPDSAQHGGDELYFT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09080		BIP3	binding protein 3, Heat shock ...		Lus10036235 [exp]	0	1
AT1G74040		IPMS2, MAML-3, ...	SOPROPYLMALATE SYNTHASE 2, 2-i...		Lus10019573 [exp]	9.2	0.8854
AT4G26300		EMB1027	embryo defective 1027, Arginyl...		Lus10034982 [exp]	15.1	0.8674
AT3G28730		NFD, SSRP1, ATH...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10042065 [exp]	16.8	0.8820
AT5G27540		MIRO1, EMB2473	embryo defective 2473, MIRO-re...		Lus10004474 [exp]	23.0	0.8571
AT5G16750		TOZ	TORMOZEMBRYO DEFECTIVE, Transd...		Lus10012706 [exp]	26.6	0.8732
AT1G15750		TPL, WSIP1	WUS-INTERACTING PROTEIN 1, TOP...		Lus10019401 [exp]	28.0	0.8526
AT5G49555			FAD/NAD(P)-binding oxidoreduct...		Lus10014308 [exp]	33.8	0.8504
AT4G26910			Dihydrolipoamide succinyltrans...		Lus10032632 [exp]	34.9	0.8523
AT5G08570			Pyruvate kinase family protein...		Lus10041003 [exp]	36.9	0.8600
AT4G34200		EDA9	embryo sac development arrest ...		Lus10027868 [exp]	41.5	0.8439

Compare expression of checked genes

Lus10036235 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.