Gene [FLAX] | FIBexDB

Lus10036239 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT5G14180	72 / 2e-15		MPL1	Myzus persicae-induced lipase 1 (.1)
AT2G15230	70 / 8e-15		ATLIP1	lipase 1 (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10031523 [exp]	75 / 2e-16	AT5G14180	410 / 1e-141	Myzus persicae-induced lipase 1 (.1)
Lus10015159 [exp]	74 / 5e-16	AT5G14180	409 / 2e-141	Myzus persicae-induced lipase 1 (.1)
Lus10023171 [exp]	73 / 1e-15	AT5G14180	358 / 3e-121	Myzus persicae-induced lipase 1 (.1)
Lus10022349 [exp]	71 / 4e-15	AT5G14180	527 / 0.0	Myzus persicae-induced lipase 1 (.1)
Lus10027861 [exp]	70 / 9e-15	AT2G15230	438 / 2e-152	lipase 1 (.1)
Lus10002808 [exp]	70 / 1e-14	AT2G15230	551 / 0.0	lipase 1 (.1)
Lus10041571 [exp]	70 / 1e-14	AT5G14180	525 / 0.0	Myzus persicae-induced lipase 1 (.1)
Lus10015158 [exp]	70 / 2e-14	AT5G14180	351 / 2e-118	Myzus persicae-induced lipase 1 (.1)
Lus10026167 [exp]	65 / 2e-13	AT5G14180	99 / 6e-24	Myzus persicae-induced lipase 1 (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.014G159900 [exp]	96 / 4e-24	AT5G14180	421 / 9e-146	Myzus persicae-induced lipase 1 (.1)
Potri.014G159800 [exp]	91 / 3e-22	AT5G14180	422 / 3e-146	Myzus persicae-induced lipase 1 (.1)
Potri.014G159700 [exp]	88 / 3e-21	AT5G14180	441 / 5e-154	Myzus persicae-induced lipase 1 (.1)
Potri.009G094900 [exp]	71 / 6e-15	AT2G15230	564 / 0.0	lipase 1 (.1)
Potri.001G332300 [exp]	67 / 8e-14	AT5G14180	533 / 0.0	Myzus persicae-induced lipase 1 (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
CL0028 [flax] [poplar]	AB_hydrolase	PF04083 [flax] [poplar]	Abhydro_lipase	Partial alpha/beta-hydrolase lipase region

Representative CDS sequence

Show only first row Show all

>Lus10036239 pacid=23169376 polypeptide=Lus10036239 locus=Lus10036239.g ID=Lus10036239.BGIv1.0 annot-version=v1.0

ATGGTCCAACCACAAGGCTATGCATGTGAAGAACATCTGGTAACAACAGAAGACGGCTACATACTTGGATTCCAGAGAATGCAAGTTTCTCGATCGGGCA

AGACTGCATATAAGCCACCAGTCCTTGTACAGCACGGATTATTCAGCGATGCTGCTTCATGGATGATCAATGGCCCTGAGGAATCCTTGCCATTCATACT

GGTGATAACGGCTACGACGTATGGATGTCGAACACTCGTGGCACTGTACCCAGCCAAGGACACACATCACTTTCCCCTAACGATGGAAAGCAGCTGCTGT

GTGAATACCTCGAGGATCGACAAGTTTCCCGACAACGAGCCTCAAGCAACATCAGTGAAGAACATAGTCCATCTATCCCAGAGTAAGTGTCTCGATCTCC

AAGCTCTTATTTATAAACCTAAGGTTTGA

AA sequence

Show only first row Show all

>Lus10036239 pacid=23169376 polypeptide=Lus10036239 locus=Lus10036239.g ID=Lus10036239.BGIv1.0 annot-version=v1.0

MVQPQGYACEEHLVTTEDGYILGFQRMQVSRSGKTAYKPPVLVQHGLFSDAASWMINGPEESLPFILVITATTYGCRTLVALYPAKDTHHFPLTMESSCC

VNTSRIDKFPDNEPQATSVKNIVHLSQSKCLDLQALIYKPKV

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10036239 [exp]	0	1

Lus10036239 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.