Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037474 [exp] 88 / 7e-24 ND / Lus10021739 [exp] 66 / 7e-15 ND / Lus10009076 [exp] 60 / 6e-13 ND / Lus10042500 [exp] 46 / 1e-07 ND / Lus10004431 [exp] 44 / 3e-06 ND / Lus10027005 [exp] 40 / 2e-05 ND 36 / 9e-04 Lus10032865 [exp] 39 / 5e-05 AT2G01050 40 / 9e-05 zinc ion binding;nucleic acid binding (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036275 pacid=23169351 polypeptide=Lus10036275 locus=Lus10036275.g ID=Lus10036275.BGIv1.0 annot-version=v1.0 ATGGCCGTGAAGAAGAGCTTACCAAACGCTTGGCAACCAATCTACGGGGTCGAGATCACACAGCTGGAAGATTATCGTCTTCTCTTCCGATTTGCACATG AAGTCGATGTTCGAAATGTAGTAGACCACGGGCCTTGGTTTTTCGACAAACAGTTGCTACTCACTCATGAACTTCAATTAGAGTACCTACCTGGAAAGAA ACCCAAATCAAAGCTGCTAGTAGGTAGGATCTCAAAAAATCGAAAGAAGGCTTTCGAAGGATACTCATCTCGCTGGAACAGAATCTACAACTCCAAACCC AAGGGCAACATTCCATAA
AA sequence Show only first row Show all	>Lus10036275 pacid=23169351 polypeptide=Lus10036275 locus=Lus10036275.g ID=Lus10036275.BGIv1.0 annot-version=v1.0 MAVKKSLPNAWQPIYGVEITQLEDYRLLFRFAHEVDVRNVVDHGPWFFDKQLLLTHELQLEYLPGKKPKSKLLVGRISKNRKKAFEGYSSRWNRIYNSKP KGNIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10036275 [exp]	0	1
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	3.9	0.9473
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	5.5	0.9466
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	6.7	0.9466
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	7.7	0.9466
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	8.7	0.9443
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	9.5	0.9442
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	10.2	0.9433
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	11.0	0.9413
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	11.6	0.9412
AT4G29035			Plant self-incompatibility pro...		Lus10011895 [exp]	12.2	0.9390

Compare expression of checked genes

Lus10036275 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.