Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04050 86 / 2e-20 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2) ATMG00520 66 / 2e-13 ATMG00520.1, MATR Intron maturase, type II family protein (.1) AT1G74350 45 / 3e-06 Intron maturase, type II family protein (.1) ATCG00040 39 / 0.0004 ATCG00040.1, MATK maturase K (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038971 [exp] 232 / 4e-73 AT5G04050 704 / 0.0 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2) Lus10027263 [exp] 231 / 4e-73 AT5G04050 690 / 0.0 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2) Lus10021359 [exp] 56 / 8e-10 AT1G74350 838 / 0.0 Intron maturase, type II family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G043650 [exp] 193 / 9e-59 AT5G04050 742 / 0.0 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2) Potri.007G062302 [exp] 68 / 2e-14 ATMG00520 1095 / 0.0 Intron maturase, type II family protein (.1) Potri.005G063750 [exp] 46 / 2e-06 AT1G74350 877 / 0.0 Intron maturase, type II family protein (.1) Potri.013G138201 [exp] 38 / 0.0007 ATCG00040 550 / 0.0 maturase K (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0359 [flax] [poplar] Intron-mat_II PF01348 [flax] [poplar] Intron_maturas2 Type II intron maturase
Representative CDS sequence Show only first row Show all	>Lus10036278 pacid=23169442 polypeptide=Lus10036278 locus=Lus10036278.g ID=Lus10036278.BGIv1.0 annot-version=v1.0 ATGGCGGGTTTTACAAACAACATGGGTCGTCCAAGGCCAATCAATTGGCTAACTAATCTCGAAGATGCCGATATCATCCGGTGGTACGCAGGGGTCGGAG AAGGATGGCTCGACTTCTTCAGCTGCGGCAATAACTTTAAAATGGCGAAGACAATCGTAACTTATCACCTGAGGTTTTCTTGTTTGCTGACATTGGCAGA GAAGCACGAGGCGACAAAACTCGAGACGATTAAACACTACACCAAGAATGTGAGAGTTTCTTTTATGGAAGGGCACGATGAATATTACTTTCCTACAGAG AAGGAAGTGAAGATGATGGGAGATAAGAATCTTGCGGATCCGAAATGGGTGCAATACATGACAGTCTGCACCGAATAA
AA sequence Show only first row Show all	>Lus10036278 pacid=23169442 polypeptide=Lus10036278 locus=Lus10036278.g ID=Lus10036278.BGIv1.0 annot-version=v1.0 MAGFTNNMGRPRPINWLTNLEDADIIRWYAGVGEGWLDFFSCGNNFKMAKTIVTYHLRFSCLLTLAEKHEATKLETIKHYTKNVRVSFMEGHDEYYFPTE KEVKMMGDKNLADPKWVQYMTVCTE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	0	1
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10022111 [exp]	1.0	0.9207
AT5G66550			Maf-like protein (.1)		Lus10040204 [exp]	1.4	0.9155
AT2G21090			Pentatricopeptide repeat (PPR-...		Lus10019213 [exp]	2.4	0.8769
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017819 [exp]	2.8	0.8595
AT3G49142			Tetratricopeptide repeat (TPR)...		Lus10027562 [exp]	6.3	0.7683
AT2G33640			DHHC-type zinc finger family p...		Lus10025157 [exp]	7.1	0.7894
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Lus10010842 [exp]	7.1	0.8483
AT4G37460		SRFR1	SUPPRESSOR OF RPS4-RLD 1, Tetr...		Lus10014863 [exp]	7.5	0.8379
					Lus10026028 [exp]	7.6	0.7839
					Lus10005785 [exp]	8.1	0.8193

Compare expression of checked genes

Lus10036278 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.