Lus10036291 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 432 / 1e-154 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT5G10960 394 / 2e-139 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 340 / 4e-118 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT3G44260 276 / 3e-93 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 273 / 1e-91 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 161 / 3e-47 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 132 / 7e-37 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 120 / 1e-32 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 119 / 7e-32 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003635 552 / 0 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017123 427 / 2e-152 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10018330 426 / 4e-152 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10034180 286 / 5e-97 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10021304 272 / 2e-91 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10004212 268 / 6e-90 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10016980 266 / 4e-88 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 150 / 3e-43 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 146 / 1e-41 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G046700 456 / 2e-164 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 451 / 2e-162 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.018G020900 442 / 1e-158 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 441 / 4e-158 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 437 / 2e-156 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 295 / 2e-100 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 290 / 1e-98 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 278 / 1e-93 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 276 / 1e-92 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 224 / 8e-73 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10036291 pacid=23169311 polypeptide=Lus10036291 locus=Lus10036291.g ID=Lus10036291.BGIv1.0 annot-version=v1.0
ATGTCGATTCTGCCTAAGAGCGAGTCAATAATTATCCGTGACGTGTGGAATGAGAATCTGGAAGATGAATTCAATTTGATTATGGACATAGTTGATGATT
TCCCTTTCATTGCAATGGACAGAGAGTTCCCTGGAATTATCGTTCGGCCCGTAGGAAATTTCAAGAACGGTTCTGACTACAATTATCAAACCCTAAAGGC
CAATGTGGATCTTCTAAAGTTGATTCAGCTTGGATTAACTTTCTCAGACGAGAATGGCAGCTTGCCAAAATGTGGGACTGGGAAGTACTGTGTCTGGCAG
TTCAACTTCCGCGAATTCAACCCGGTTGAGGATTTCTATGCCGATGACTCCATAGAGCTTCTGACACAGAGTGGCATTGATTTCCAGAAGAACACCGAGG
TGGGTGTCGATACCAAGCGATTTAGCGAGTTGCTAATGTCGTCGGGGATTGTGTTGAATGACAGTGTGCATTGGGTTACTTTCCATAGTGGGTATGATTT
TGGATACCTGTTAAAGCTTCTCACTTGCAAGAACCTTCCTGACACACAATCAGAGTTCTTCAAGTTGATCAGGTTATACTTCCCTGTGCTCTATGATATT
AAGCACCTGGTCAAGTTCTGCAATAGTCTTCATGGTGGATTGAACAAGCTAGCGGAGCTGTTGGATGTGGAGAGGATTGGAATCTGTCATCAAGCCGGCT
CGGATAGTTTGCTTACATGTTGTACATTCATGAAATTGAAAGAGAGTTTCTTCAATGGTTCGACGGAGAAGTATGTTGGTGTGCTTTATGGCCTTGGTGT
TGAGAATGGTCAGAATGCTCATTAA
AA sequence
>Lus10036291 pacid=23169311 polypeptide=Lus10036291 locus=Lus10036291.g ID=Lus10036291.BGIv1.0 annot-version=v1.0
MSILPKSESIIIRDVWNENLEDEFNLIMDIVDDFPFIAMDREFPGIIVRPVGNFKNGSDYNYQTLKANVDLLKLIQLGLTFSDENGSLPKCGTGKYCVWQ
FNFREFNPVEDFYADDSIELLTQSGIDFQKNTEVGVDTKRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCKNLPDTQSEFFKLIRLYFPVLYDI
KHLVKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTCCTFMKLKESFFNGSTEKYVGVLYGLGVENGQNAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32070 Polynucleotidyl transferase, r... Lus10036291 0 1
AT2G32070 Polynucleotidyl transferase, r... Lus10003635 2.6 0.8680
AT5G43940 PAR2, ATGSNOR1,... PARAQUAT RESISTANT 2, sensitiv... Lus10022853 2.8 0.8209
AT3G05640 Protein phosphatase 2C family ... Lus10020671 3.0 0.8221
AT5G27930 Protein phosphatase 2C family ... Lus10020670 3.2 0.8122
AT5G56450 PM-ANT Mitochondrial substrate carrie... Lus10013518 3.3 0.7528
AT3G22430 unknown protein Lus10021917 3.7 0.7895
AT1G31830 Amino acid permease family pro... Lus10007593 4.7 0.8243
AT1G08800 Protein of unknown function, D... Lus10024869 6.9 0.7527
AT2G43770 Transducin/WD40 repeat-like su... Lus10002211 9.4 0.7783
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Lus10021410 13.2 0.8034

Lus10036291 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.