Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14290 49 / 3e-08 SBH2 sphingoid base hydroxylase 2 (.1) AT1G69640 47 / 1e-07 SBH1 sphingoid base hydroxylase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037183 [exp] 80 / 1e-19 AT1G69640 422 / 3e-151 sphingoid base hydroxylase 1 (.1) Lus10036744 [exp] 78 / 6e-19 AT1G14290 421 / 7e-151 sphingoid base hydroxylase 2 (.1) Lus10012832 [exp] 64 / 2e-13 AT1G14290 414 / 5e-148 sphingoid base hydroxylase 2 (.1) Lus10030481 [exp] 61 / 1e-12 AT1G14290 414 / 4e-148 sphingoid base hydroxylase 2 (.1) Lus10028725 [exp] 41 / 2e-05 AT1G14290 358 / 3e-126 sphingoid base hydroxylase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G061400 [exp] 42 / 1e-05 AT1G69640 311 / 1e-107 sphingoid base hydroxylase 1 (.1) Potri.005G200000 [exp] 40 / 7e-05 AT1G69640 315 / 7e-109 sphingoid base hydroxylase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036293 pacid=23169425 polypeptide=Lus10036293 locus=Lus10036293.g ID=Lus10036293.BGIv1.0 annot-version=v1.0 ATGGGAGGTTTTCAAATCACAGACGAATTGTTGAGTACGTTTGTTCCGATTGTGGTTTATTGGGGTTGTTCTGGGATAAATTGTCTCCTTGGATGGCTAG ATGGTTACATGCTGCACTTGAAGCAGGACTCCGATGACGAAGACAACGATGATGATGGCGGTGATGGTGAAGACAATTTTTTTAGGAGCTGTGTTGAGGA GAAGGAGAAGATGAAGAGTGGGTCAAACCGATTTGGTTTAAGTAAAATGAATGATTTAGTTTGA
AA sequence Show only first row Show all	>Lus10036293 pacid=23169425 polypeptide=Lus10036293 locus=Lus10036293.g ID=Lus10036293.BGIv1.0 annot-version=v1.0 MGGFQITDELLSTFVPIVVYWGCSGINCLLGWLDGYMLHLKQDSDDEDNDDDGGDGEDNFFRSCVEEKEKMKSGSNRFGLSKMNDLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10036293 [exp]	0	1
					Lus10000273 [exp]	2.8	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	5.1	1.0000
AT1G04670			unknown protein		Lus10002298 [exp]	5.2	1.0000
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	7.5	1.0000
					Lus10027667 [exp]	8.1	1.0000
					Lus10032828 [exp]	8.5	1.0000
					Lus10015682 [exp]	8.8	1.0000
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10033306 [exp]	8.9	1.0000
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10032524 [exp]	8.9	1.0000
					Lus10019051 [exp]	9.4	1.0000

Compare expression of checked genes

Lus10036293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.