Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19810 216 / 2e-68 ChiC class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19820 188 / 1e-57 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19800 188 / 2e-57 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19750 167 / 2e-49 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19760 164 / 2e-48 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19720 164 / 2e-48 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19730 148 / 1e-42 Glycosyl hydrolase superfamily protein (.1) AT4G19770 83 / 1e-18 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19740 67 / 4e-13 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019060 [exp] 383 / 1e-130 AT4G19810 437 / 1e-149 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036306 [exp] 292 / 4e-98 AT4G19810 397 / 6e-138 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036311 [exp] 180 / 3e-54 AT4G19810 377 / 5e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036315 [exp] 127 / 5e-34 AT4G19820 253 / 3e-81 Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10018329 [exp] 124 / 6e-33 AT4G19810 268 / 1e-86 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10017124 [exp] 118 / 9e-31 AT4G19810 260 / 9e-84 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10040021 [exp] 117 / 1e-29 AT4G19810 278 / 5e-89 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10041639 [exp] 112 / 6e-28 AT4G11900 338 / 7e-104 S-locus lectin protein kinase family protein (.1) Lus10019061 [exp] 112 / 1e-27 AT4G21380 338 / 5e-104 receptor kinase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G188300 [exp] 254 / 2e-83 AT4G19810 379 / 2e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G188400 [exp] 227 / 7e-73 AT4G19810 477 / 2e-169 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G111700 [exp] 147 / 7e-40 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111600 [exp] 146 / 1e-39 AT4G23180 377 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.018G111800 [exp] 145 / 3e-39 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111900 [exp] 143 / 1e-38 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.006G261800 [exp] 139 / 6e-38 AT4G19810 286 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G262001 [exp] 137 / 8e-38 AT4G19810 283 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112000 [exp] 133 / 2e-36 AT4G19810 284 / 3e-93 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112100 [exp] 132 / 5e-36 AT4G19810 279 / 3e-91 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00704 [flax] [poplar] Glyco_hydro_18 Glycosyl hydrolases family 18
Representative CDS sequence Show only first row Show all	>Lus10036310 pacid=23169338 polypeptide=Lus10036310 locus=Lus10036310.g ID=Lus10036310.BGIv1.0 annot-version=v1.0 ATGCCGGCTTCCAAACAACTTATCCCCTTCACCCTCGCCGTCGTCCTCCTCATCCTTATCCATTCCACTGCCGCCCAACCCGCCGTAGTCAGAGGTGGGT ACTGGTTCCCGGAAAGTGGGTTTGCTGTCTCGGCCATCAATTCCAACCATTTCACTCATCTCTTCTGTGCATTCGCCGGGGTTGACCCCGTTACCTTCCA ACTCACCGTCCCAGCCGAAAATCGGCAGCAGTTTATGACCTTTACCCAGACGGTGCAGAGTAAGAACCCGTCGGTTAGAACCCTTTTGTCCATCGGCGGC GGCAGAGCTAACGTCACTACTCTTGCGGCGATGGCGAGCCAGCCCGGTCGAAGGAAGTCTTTCATTGATACTTCCATAAGCACTGCTAGGTCGTTCAATT TCCACGGCCTCGACCTGGATTGGGAGTACCCATCCGACACAACCCAAATGGCCAATTTCGGATCGCTCTTAATCGAATGGAGAGCCGCCGTAGCCGCGGA CGCCAGAAACTCCGGGAAGCCACCTCTACTCCTATCGGCGGCGGTGCTCTACTTGCCGTACTACTACTCTTCCTCTGTTCCTTACCCTGTTCGAACAATA TCAAACTCCTTGGATTGGATCAACCTAATGGCCTATGATTTCTTCGCCCCCGGGTGGACGCCGACCACAACCGGACCTCCGGCGGCTTTGTTCAACCCCG GCCGTCGTGAGAGCGGCGACCACGGCGCTAGCTCGTGGCACACAGCCGCGCGCGCGGGCGAAGAAAATCGTGCTCGGAATGCCGTTCTACGGATGGTCGT GGCAGCTTAA
AA sequence Show only first row Show all	>Lus10036310 pacid=23169338 polypeptide=Lus10036310 locus=Lus10036310.g ID=Lus10036310.BGIv1.0 annot-version=v1.0 MPASKQLIPFTLAVVLLILIHSTAAQPAVVRGGYWFPESGFAVSAINSNHFTHLFCAFAGVDPVTFQLTVPAENRQQFMTFTQTVQSKNPSVRTLLSIGG GRANVTTLAAMASQPGRRKSFIDTSISTARSFNFHGLDLDWEYPSDTTQMANFGSLLIEWRAAVAADARNSGKPPLLLSAAVLYLPYYYSSSVPYPVRTI SNSLDWINLMAYDFFAPGWTPTTTGPPAALFNPGRRESGDHGASSWHTAARAGEENRARNAVLRMVVAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Lus10036310 [exp]	0	1
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10038526 [exp]	5.1	0.9664
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Lus10041511 [exp]	7.1	0.9669
AT4G01575			serine protease inhibitor, Kaz...		Lus10030164 [exp]	7.4	0.9615
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031158 [exp]	7.6	0.9390
AT5G53450		ORG1	OBP3-responsive gene 1 (.1.2)		Lus10014920 [exp]	8.8	0.9509
AT5G53550		ATYSL3, YSL3	YELLOW STRIPE like 3 (.1.2)		Lus10032950 [exp]	9.8	0.9606
AT5G53450		ORG1	OBP3-responsive gene 1 (.1.2)		Lus10038813 [exp]	10.2	0.9368
AT5G44390			FAD-binding Berberine family p...		Lus10038442 [exp]	10.2	0.9600
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10005262 [exp]	11.4	0.9640
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10008606 [exp]	17.1	0.8789

Compare expression of checked genes

Lus10036310 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.