Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01700 177 / 5e-55 ATROPGEF2, ROPGEF2 RHO guanyl-nucleotide exchange factor 2 (.1) AT4G00460 172 / 4e-53 ATROPGEF3, ROPGEF3 RHO guanyl-nucleotide exchange factor 3 (.1.2) AT2G45890 150 / 1e-44 RHS11, ATROPGEF4, ROPGEF4 ROOT HAIR SPECIFIC 11, RHO guanyl-nucleotide exchange factor 4 (.1) AT5G02010 115 / 3e-31 ATROPGEF7, ROPGEF7 RHO guanyl-nucleotide exchange factor 7 (.1) AT3G55660 108 / 1e-28 ATROPGEF6, ROPGEF6 ROP (rho of plants) guanine nucleotide exchange factor 6 (.1) AT4G38430 107 / 1e-28 ATROPGEF1, ROPGEF1 rho guanyl-nucleotide exchange factor 1 (.1) AT5G05940 104 / 2e-27 ATROPGEF5, ROPGEF5 ROP guanine nucleotide exchange factor 5 (.1) AT1G52240 103 / 7e-27 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G24620 102 / 1e-26 ATROPGEF8, ROPGEF8 RHO guanyl-nucleotide exchange factor 8 (.1) AT4G13240 102 / 1e-26 ATROPGEF9, ROPGEF9 RHO guanyl-nucleotide exchange factor 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014779 [exp] 224 / 9e-73 AT1G01700 554 / 0.0 RHO guanyl-nucleotide exchange factor 2 (.1) Lus10040248 [exp] 123 / 5e-34 AT5G05940 661 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10004676 [exp] 122 / 1e-33 AT5G05940 667 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10009874 [exp] 111 / 9e-30 AT5G05940 643 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10025101 [exp] 108 / 6e-29 AT4G38430 683 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Lus10000399 [exp] 107 / 2e-28 AT5G05940 630 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10023983 [exp] 107 / 3e-28 AT4G38430 696 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Lus10038560 [exp] 105 / 4e-28 AT1G79860 565 / 0.0 MATERNAL EFFECT EMBRYO ARREST 64, RHO guanyl-nucleotide exchange factor 12 (.1) Lus10037866 [exp] 103 / 3e-27 AT1G79860 591 / 0.0 MATERNAL EFFECT EMBRYO ARREST 64, RHO guanyl-nucleotide exchange factor 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G159700 [exp] 185 / 6e-58 AT4G00460 662 / 0.0 RHO guanyl-nucleotide exchange factor 3 (.1.2) Potri.014G084200 [exp] 177 / 5e-55 AT4G00460 673 / 0.0 RHO guanyl-nucleotide exchange factor 3 (.1.2) Potri.004G179742 [exp] 113 / 2e-30 AT4G38430 729 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Potri.010G196000 [exp] 112 / 3e-30 AT5G05940 659 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Potri.016G104400 [exp] 112 / 3e-30 AT5G02010 632 / 0.0 RHO guanyl-nucleotide exchange factor 7 (.1) Potri.008G062000 [exp] 112 / 3e-30 AT5G05940 664 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Potri.006G092600 [exp] 111 / 9e-30 AT5G02010 676 / 0.0 RHO guanyl-nucleotide exchange factor 7 (.1) Potri.009G140100 [exp] 110 / 1e-29 AT4G38430 715 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Potri.018G082400 [exp] 108 / 5e-29 AT3G24620 597 / 0.0 RHO guanyl-nucleotide exchange factor 8 (.1) Potri.005G247100 [exp] 105 / 9e-28 AT4G38430 553 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03759 [flax] [poplar] PRONE PRONE (Plant-specific Rop nucleotide exchanger)
Representative CDS sequence Show only first row Show all	>Lus10036353 pacid=23174470 polypeptide=Lus10036353 locus=Lus10036353.g ID=Lus10036353.BGIv1.0 annot-version=v1.0 ATGTACACATGGCGGCGCAAGGCTTGCCTGAGCAATTCGAGATCATCGTGGGGGGACTTGGTGAAAGACCTTGTGTATGAAATGGACAGGATAGACAAGA ACCATGTGTTAGCACAGAGGGCAGAGAGCTTGCTCTTCTGCTTGAAGCAAAGGTATCCCGGGCTTTCGCAGACATCGTTGGATATATGCAAGATCCAGTG CAATCGGGATGTGGGACAGGCAATACTGGAGAGCTACTCAAGGGTGTTGGAAGGTCTGGCATTCAACATTGTTGCATGGATTGAAGATGTTCTTTTTGTA GATAAATCTGTTAAGAGCCAACAGTAA
AA sequence Show only first row Show all	>Lus10036353 pacid=23174470 polypeptide=Lus10036353 locus=Lus10036353.g ID=Lus10036353.BGIv1.0 annot-version=v1.0 MYTWRRKACLSNSRSSWGDLVKDLVYEMDRIDKNHVLAQRAESLLFCLKQRYPGLSQTSLDICKIQCNRDVGQAILESYSRVLEGLAFNIVAWIEDVLFV DKSVKSQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00460		ATROPGEF3, ROPG...	RHO guanyl-nucleotide exchange...		Lus10036353 [exp]	0	1
AT1G01700		ATROPGEF2, ROPG...	RHO guanyl-nucleotide exchange...		Lus10036352 [exp]	1.4	0.9376
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10021428 [exp]	3.5	0.9297
AT4G00460		ATROPGEF3, ROPG...	RHO guanyl-nucleotide exchange...		Lus10036351 [exp]	6.5	0.8884
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10016659 [exp]	8.5	0.8966
AT3G14470			NB-ARC domain-containing disea...		Lus10042117 [exp]	9.0	0.9175
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10024648 [exp]	9.5	0.8970
AT2G15730			P-loop containing nucleoside t...		Lus10021749 [exp]	9.7	0.8712
AT5G43060			Granulin repeat cysteine prote...		Lus10027877 [exp]	9.8	0.9005
AT2G17080			Arabidopsis protein of unknown...		Lus10014448 [exp]	10.4	0.8907
AT3G14590		NTMCTYPE6.2 ,NT...	Calcium-dependent lipid-bindin...		Lus10042475 [exp]	11.0	0.8967

Compare expression of checked genes

Lus10036353 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.