Gene [FLAX] | FIBexDB

Lus10036360 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TAIR10 short description
AT4G04690	63 / 2e-11	F-box and associated interaction domains-containing protein (.1)
AT3G10430	44 / 5e-05	F-box and associated interaction domains-containing protein (.1)
AT3G06240	42 / 0.0001	F-box family protein (.1)
AT3G08750	40 / 0.0005	F-box and associated interaction domains-containing protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10023372 [exp]	159 / 5e-46	AT3G16210	67 / 5e-12	F-box family protein (.1)
Lus10015408 [exp]	153 / 8e-44	AT3G16210	64 / 6e-11	F-box family protein (.1)
Lus10028961 [exp]	133 / 2e-36	AT4G12560	81 / 2e-16	CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10024677 [exp]	127 / 4e-36	ND	42 / 2e-04
Lus10013988 [exp]	126 / 4e-33	AT3G49180	471 / 4e-160	ROOT INITIATION DEFECTIVE 3, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10001105 [exp]	90 / 8e-21	AT3G06240	109 / 3e-26	F-box family protein (.1)
Lus10023370 [exp]	87 / 3e-20	ND	37 / 0.008
Lus10009424 [exp]	80 / 5e-17	AT3G06240	73 / 9e-14	F-box family protein (.1)
Lus10007485 [exp]	77 / 2e-16	ND	/

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.012G099733 [exp]	48 / 3e-06	AT3G16210	92 / 2e-20	F-box family protein (.1)
Potri.012G014300 [exp]	44 / 6e-05	AT3G16210	88 / 6e-19	F-box family protein (.1)
Potri.005G114900 [exp]	43 / 0.0001	AT3G21410	73 / 9e-14	F-box and associated interaction domains-containing protein (.1)
Potri.017G058000 [exp]	43 / 0.0001	AT3G06240	138 / 5e-37	F-box family protein (.1)
Potri.017G012200 [exp]	42 / 0.0001	AT4G12560	86 / 4e-18	CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.014G162600 [exp]	41 / 0.0004	AT3G07870	467 / 9e-164	F-box and associated interaction domains-containing protein (.1)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10036360 pacid=23174611 polypeptide=Lus10036360 locus=Lus10036360.g ID=Lus10036360.BGIv1.0 annot-version=v1.0

ATGTTCGCTTTTTTGAAAGAATTCAGATTGAACAAAGGTACGGAATCGACAGACTGTTCCTCGATATACTCGTACGAAACACTCCGCCCAATCACAGGCC

ACCGCAACGATCTTCCCGCACCCGACGGCGACGGATGGCTCGACGTGATTGGATGCTGCGATGGGATTTTCTGTATATCCCATTTGAGGAGCAGCCGAAT

AGGGTTCGTTTCTTACAACATCGTTCTTTGGAATCCGGTGACCTCCGAGACCAAAATCCTTCCTCCTGGCCCTCATCACCCTGCTCGCACTCCCTATACT

AAGCCGCTATGGGTTCATTATGGTGCAGAGTACATTGGTTTCAGATTCGATCCCAGAACTTACCATGGTCCTCTTCCCCTTGTTTTTACAGAGGTTTATA

GCCTGAGGAATGATTCATGGAAGACACTAGATGTGAGTTACGATCGAGTTTTTAACCAAGTTGGAGCCACATATCTCCATCAGCAGTGGGACATATCTCG

AAACGATAAGTGTTACTGGATGGATGGAGTTCGTGAGCTTGTTTCGTTCGACATGAGTACCAAAGTGTTTGAATATGTATATGTCGCACCTCCCCAGTCC

CCTGGCCTTCGTGACTTCGCCGTGTCGGGTTTCATGTTGGTGGGGATGGTTGTGATCACATTCTTCGGTGAAATATGGAGTTGCTGA

AA sequence

Show only first row Show all

>Lus10036360 pacid=23174611 polypeptide=Lus10036360 locus=Lus10036360.g ID=Lus10036360.BGIv1.0 annot-version=v1.0

MFAFLKEFRLNKGTESTDCSSIYSYETLRPITGHRNDLPAPDGDGWLDVIGCCDGIFCISHLRSSRIGFVSYNIVLWNPVTSETKILPPGPHHPARTPYT

KPLWVHYGAEYIGFRFDPRTYHGPLPLVFTEVYSLRNDSWKTLDVSYDRVFNQVGATYLHQQWDISRNDKCYWMDGVRELVSFDMSTKVFEYVYVAPPQS

PGLRDFAVSGFMLVGMVVITFFGEIWSC

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G04690			F-box and associated interacti...		Lus10036360 [exp]	0	1

Lus10036360 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.