Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01600 86 / 4e-21 CYP86A4 "cytochrome P450, family 86, subfamily A, polypeptide 4", cytochrome P450, family 86, subfamily A, polypeptide 4 (.1) AT2G45970 86 / 5e-21 CYP86A8, LCR LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) AT4G00360 83 / 2e-20 ATT1, CYP86A2 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) AT1G63710 79 / 6e-19 CYP86A7 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) AT5G58860 61 / 2e-12 CYP86A1 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) AT5G08250 56 / 1e-10 Cytochrome P450 superfamily protein (.1) AT5G23190 56 / 2e-10 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) AT1G13150 51 / 6e-09 CYP86C4 "cytochrome P450, family 86, subfamily C, polypeptide 4", cytochrome P450, family 86, subfamily C, polypeptide 4 (.1) AT1G13140 49 / 3e-08 CYP86C3 "cytochrome P450, family 86, subfamily C, polypeptide 3", cytochrome P450, family 86, subfamily C, polypeptide 3 (.1.2) AT3G26125 47 / 2e-07 CYP86C2 "cytochrome P450, family 86, subfamily C, polypeptide 2", cytochrome P450, family 86, subfamily C, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014768 [exp] 134 / 4e-38 AT4G00360 756 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10018831 [exp] 88 / 1e-22 AT4G00360 403 / 8e-139 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10024644 [exp] 79 / 1e-18 AT1G63710 562 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Lus10032278 [exp] 77 / 6e-18 AT1G63710 792 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Lus10040687 [exp] 68 / 6e-15 AT5G58860 803 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Lus10018217 [exp] 68 / 8e-15 AT5G58860 802 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Lus10010193 [exp] 54 / 9e-10 AT5G23190 741 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10017394 [exp] 52 / 4e-09 AT5G23190 739 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10040986 [exp] 51 / 6e-09 AT5G23190 751 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G085800 [exp] 92 / 2e-23 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.003G129100 [exp] 78 / 2e-18 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Potri.009G043700 [exp] 64 / 2e-13 AT5G58860 827 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.001G249700 [exp] 64 / 2e-13 AT5G58860 790 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.008G183300 [exp] 47 / 2e-07 AT1G24540 682 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.007G072100 [exp] 46 / 3e-07 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.010G050100 [exp] 46 / 4e-07 AT1G24540 684 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.005G092200 [exp] 45 / 1e-06 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.005G064400 [exp] 42 / 6e-06 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.007G080300 [exp] 41 / 2e-05 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036367 pacid=23174583 polypeptide=Lus10036367 locus=Lus10036367.g ID=Lus10036367.BGIv1.0 annot-version=v1.0 ATGAAGTCGGTGGCGGCGGCGGTGTTGCTCCGGCACCGGCTGACGGTGGCGGAGGGGCATAAGGTGGAGCAGAAGATGTCCTTGACTCTGTTCATGAAAT ACGGGCTGAAGGTCAACGTGTTTAAGAGAGACCTGGAAGAGACGGTGGCGGCGATGCTGAAGAAGCCGGCGGCAACCGTGGTCAGCGACGTTGAGGATAA AGGACAAAATTGTAATTGTGAGAAAGCGGAGGCATTGGCAGTTGCGGTGGTGTAA
AA sequence Show only first row Show all	>Lus10036367 pacid=23174583 polypeptide=Lus10036367 locus=Lus10036367.g ID=Lus10036367.BGIv1.0 annot-version=v1.0 MKSVAAAVLLRHRLTVAEGHKVEQKMSLTLFMKYGLKVNVFKRDLEETVAAMLKKPAATVVSDVEDKGQNCNCEKAEALAVAVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00360		ATT1, CYP86A2	"cytochrome P450, family 86, s...		Lus10036367 [exp]	0	1
AT3G07840			Pectin lyase-like superfamily ...		Lus10003001 [exp]	7.9	0.8443
AT3G27890		NQR	NADPH:quinone oxidoreductase (...		Lus10039505 [exp]	11.6	0.8663
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Lus10001643 [exp]	23.5	0.8105
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10010575 [exp]	27.2	0.8295
AT5G09530		PRP10, PELPK1	proline-rich protein 10, Pro-G...		Lus10018841 [exp]	33.8	0.8215
					Lus10014682 [exp]	37.1	0.7990
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10042611 [exp]	38.9	0.8261
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006908 [exp]	41.0	0.7826
AT3G22890		APS1	ATP sulfurylase 1 (.1)		Lus10006629 [exp]	50.0	0.8130
AT2G23910			NAD(P)-binding Rossmann-fold s...		Lus10006885 [exp]	54.2	0.8241

Compare expression of checked genes

Lus10036367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.