Lus10036380 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05280 96 / 2e-25 RING/U-box superfamily protein (.1)
AT5G01880 92 / 6e-24 RING/U-box superfamily protein (.1)
AT3G10910 89 / 8e-23 RING/U-box superfamily protein (.1)
AT1G20823 85 / 4e-21 RING/U-box superfamily protein (.1)
AT1G76410 81 / 2e-19 ATL8 RING/U-box superfamily protein (.1)
AT1G49210 81 / 4e-19 RING/U-box superfamily protein (.1)
AT1G49200 81 / 4e-19 RING/U-box superfamily protein (.1)
AT1G49220 81 / 7e-19 RING/U-box superfamily protein (.1)
AT1G49230 80 / 8e-19 RING/U-box superfamily protein (.1)
AT4G17905 81 / 1e-18 ATL4H RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025146 108 / 2e-30 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1)
Lus10025145 100 / 1e-27 AT5G01880 96 / 6e-26 RING/U-box superfamily protein (.1)
Lus10022743 99 / 1e-26 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10025228 96 / 8e-26 AT5G01880 97 / 5e-26 RING/U-box superfamily protein (.1)
Lus10029037 94 / 2e-24 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10025144 91 / 1e-23 AT5G01880 87 / 5e-22 RING/U-box superfamily protein (.1)
Lus10006787 85 / 9e-21 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1)
Lus10006785 84 / 3e-20 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
Lus10005817 84 / 5e-20 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G136200 106 / 3e-29 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.019G130100 97 / 6e-26 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Potri.013G091300 96 / 4e-25 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.005G099000 96 / 5e-25 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Potri.013G157000 90 / 4e-23 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1)
Potri.019G057700 89 / 1e-22 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.001G309600 87 / 2e-21 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.019G010500 86 / 3e-21 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Potri.003G075200 82 / 6e-20 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Potri.001G309700 82 / 2e-19 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10036380 pacid=23174680 polypeptide=Lus10036380 locus=Lus10036380.g ID=Lus10036380.BGIv1.0 annot-version=v1.0
ATGCACCGCCTCATGCTGCTCGATTCGCCGCAGGACTTGGGTTTTCAGTTGGCGCATAACACCACCGACCCAGGAATTGATATCGAGGCTGAGCGCCGAC
ACATGTGTCTTTTTGTAGCAGGCGTGGTCTTCATCTTGATCTCTTTTATTGGCTATATCTGGTACGACATCCTCTACGGTCAACCCAACCTGCCGCCGCC
AACGTCGGCGGCTGCTGCTGCTATCAATAGTGGTGGTCATAACCTGAGGTTGAGCCAAGTGTTCAGCTACGGGTCTGTTGCACGTGAGATGATGTCGACG
ACCGAGTGCTCGATTTGTTTGGGCGAGTTCTCGGATGGGGAGAAAGTTCGGGTCCTGCCCGAATGTAACCATGGGTTCCACGTGGTTTGCATCGACGGGT
GGCTGGCGTTGCACTCCTCTTGCCCCAACTGTCGGCATTCGGTGGCTGCCCCGTGCCCGAGGCTGCCGGGAAATTGA
AA sequence
>Lus10036380 pacid=23174680 polypeptide=Lus10036380 locus=Lus10036380.g ID=Lus10036380.BGIv1.0 annot-version=v1.0
MHRLMLLDSPQDLGFQLAHNTTDPGIDIEAERRHMCLFVAGVVFILISFIGYIWYDILYGQPNLPPPTSAAAAAINSGGHNLRLSQVFSYGSVAREMMST
TECSICLGEFSDGEKVRVLPECNHGFHVVCIDGWLALHSSCPNCRHSVAAPCPRLPGN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05280 RING/U-box superfamily protein... Lus10036380 0 1
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 4.2 1.0000
AT2G15220 Plant basic secretory protein ... Lus10001608 6.0 1.0000
AT4G14746 unknown protein Lus10035902 7.3 0.9450
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 7.3 1.0000
Lus10024141 8.5 1.0000
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 9.5 1.0000
Lus10013255 10.4 1.0000
Lus10013259 11.2 1.0000
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10013964 12.0 1.0000
AT3G06240 F-box family protein (.1) Lus10014136 12.7 1.0000

Lus10036380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.