Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01310 81 / 4e-20 Ribosomal L5P family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007915 [exp] 119 / 2e-34 AT4G01310 364 / 3e-128 Ribosomal L5P family protein (.1) Lus10036390 [exp] 119 / 2e-34 AT4G01310 349 / 1e-121 Ribosomal L5P family protein (.1) Lus10033169 [exp] 107 / 2e-31 AT4G01310 238 / 3e-80 Ribosomal L5P family protein (.1) Lus10010251 [exp] 80 / 9e-21 AT4G01310 179 / 2e-57 Ribosomal L5P family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G154600 [exp] 79 / 2e-19 AT4G01310 361 / 4e-127 Ribosomal L5P family protein (.1) Potri.014G089100 [exp] 66 / 2e-14 AT4G01310 311 / 3e-107 Ribosomal L5P family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00673 [flax] [poplar] Ribosomal_L5_C ribosomal L5P family C-terminus
Representative CDS sequence Show only first row Show all	>Lus10036391 pacid=23174626 polypeptide=Lus10036391 locus=Lus10036391.g ID=Lus10036391.BGIv1.0 annot-version=v1.0 ATGAATGCAGACATTCATCAGGTGATGTGGGCATTCTTAGACAGGCTGATAAACTTGGGGATACCAAGGACAAGGGATTTCCAAGGACTGAATCCAAACA GCTTCGACGGACATGGGAACTTTAGGATCAGGATAAGAGAGCAGGGGACGATGCTGGTCCCCGATGCCAGTGGTTTGGTACGGAAGAAAAAGTTGAAGTC CCACCATTACGACCCGAAAGCCAGAGGGAAGTCTACTAGAAGACGTTAA
AA sequence Show only first row Show all	>Lus10036391 pacid=23174626 polypeptide=Lus10036391 locus=Lus10036391.g ID=Lus10036391.BGIv1.0 annot-version=v1.0 MNADIHQVMWAFLDRLINLGIPRTRDFQGLNPNSFDGHGNFRIRIREQGTMLVPDASGLVRKKKLKSHHYDPKARGKSTRRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01310			Ribosomal L5P family protein (...		Lus10036391 [exp]	0	1
AT5G02920			F-box/RNI-like superfamily pro...		Lus10035325 [exp]	1.4	0.9870
AT5G44440			FAD-binding Berberine family p...		Lus10010643 [exp]	1.7	0.9782
					Lus10020451 [exp]	4.0	0.9842
AT3G55210	NAC	ANAC063	NAC domain containing protein ...		Lus10031639 [exp]	4.9	0.9654
AT3G45740			hydrolase family protein / HAD...		Lus10040363 [exp]	5.0	0.8670
AT4G13230			Late embryogenesis abundant pr...		Lus10011889 [exp]	5.3	0.9755
					Lus10021851 [exp]	7.1	0.9749
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10004530 [exp]	7.7	0.9749
AT2G20030			RING/U-box superfamily protein...		Lus10000885 [exp]	8.3	0.9055
					Lus10008791 [exp]	8.4	0.9749

Compare expression of checked genes

Lus10036391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.