Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024216 [exp] 79 / 2e-19 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10001095 [exp] 66 / 3e-14 ND 38 / 0.002 Lus10037707 [exp] 67 / 9e-14 AT3G16780 343 / 8e-118 Ribosomal protein L19e family protein (.1) Lus10026443 [exp] 64 / 4e-13 ND / Lus10030119 [exp] 63 / 9e-13 ND / Lus10029801 [exp] 63 / 1e-12 ND / Lus10009207 [exp] 62 / 2e-12 ND / Lus10005217 [exp] 62 / 5e-12 AT3G20660 221 / 2e-76 organic cation/carnitine transporter4 (.1) Lus10035493 [exp] 60 / 2e-11 AT4G11450 462 / 2e-151 Protein of unknown function (DUF3527) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036397 pacid=23174520 polypeptide=Lus10036397 locus=Lus10036397.g ID=Lus10036397.BGIv1.0 annot-version=v1.0 ATGATTGCTTGGGTCGACGCGACGAGCAATACTGACAAGGGCAAGGGGACTCAGCCCTCTTGGGCAACGACTGTTGGCGATAAGGACGCAAATTTAAAGT TTGTGAGTATTCCTTTTATGGATGGAAGGCTAACTATTTCGAAGGAAATCGTGGAGAAAGGAAGAGCAAAGATGCGAGCAGCGGCGGTTGCGCAATTCGT TGGCTCAACTCCTCCAATTCGTGTTTTTGTTTCTATGATCAATAGATTGTGGAGTTCTGAAGGCGAGGGTTTGCATATTCATCATATGCCTCTGATTCTC CGGCAATGGAAGCCTGATATCAATCTCTTTGTTTGGATAAGGCTCCAAAACGTCCCTCCGCAACTCATCACTAAGGAAGGGATTGAATAA
AA sequence Show only first row Show all	>Lus10036397 pacid=23174520 polypeptide=Lus10036397 locus=Lus10036397.g ID=Lus10036397.BGIv1.0 annot-version=v1.0 MIAWVDATSNTDKGKGTQPSWATTVGDKDANLKFVSIPFMDGRLTISKEIVEKGRAKMRAAAVAQFVGSTPPIRVFVSMINRLWSSEGEGLHIHHMPLIL RQWKPDINLFVWIRLQNVPPQLITKEGIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10036397 [exp]	0	1
AT4G14590		EMB2739	embryo defective 2739 (.1)		Lus10032903 [exp]	6.3	0.7591
					Lus10031413 [exp]	54.6	0.6881
AT5G13010		EMB3011	embryo defective 3011, RNA hel...		Lus10009600 [exp]	190.1	0.6951
AT4G20140		GSO1	GASSHO1, Leucine-rich repeat t...		Lus10033519 [exp]	230.2	0.6894
AT3G12690		AGC1.5	AGC kinase 1.5 (.1.2.3)		Lus10001757 [exp]	241.2	0.6903

Compare expression of checked genes

Lus10036397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.