Lus10036404 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61550 104 / 6e-29 RING/U-box superfamily protein (.1)
AT2G46160 101 / 7e-28 RING/U-box superfamily protein (.1)
AT2G35910 74 / 4e-17 RING/U-box superfamily protein (.1)
AT5G06490 68 / 6e-15 RING/U-box superfamily protein (.1)
AT2G20030 68 / 2e-14 RING/U-box superfamily protein (.1)
AT2G46493 66 / 2e-14 RING/U-box superfamily protein (.1)
AT5G53110 68 / 3e-14 RING/U-box superfamily protein (.1)
AT2G25409 65 / 4e-14 unknown protein
AT5G40250 66 / 8e-14 RING/U-box superfamily protein (.1)
AT5G07040 64 / 1e-13 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041079 145 / 4e-45 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1)
Lus10023086 69 / 1e-14 AT5G53110 161 / 1e-59 RING/U-box superfamily protein (.1)
Lus10032382 68 / 3e-14 AT5G53110 237 / 1e-74 RING/U-box superfamily protein (.1)
Lus10034953 67 / 6e-14 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1)
Lus10012628 67 / 7e-14 AT5G53110 284 / 5e-93 RING/U-box superfamily protein (.1)
Lus10025146 64 / 8e-14 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1)
Lus10003400 63 / 3e-13 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1)
Lus10005389 63 / 3e-13 AT5G07040 154 / 9e-49 RING/U-box superfamily protein (.1)
Lus10036380 62 / 3e-13 AT5G05280 96 / 2e-25 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G091000 120 / 2e-35 AT3G61550 176 / 1e-55 RING/U-box superfamily protein (.1)
Potri.002G165200 117 / 2e-34 AT3G61550 204 / 5e-67 RING/U-box superfamily protein (.1)
Potri.010G243400 72 / 7e-17 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1)
Potri.006G201500 70 / 5e-16 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1)
Potri.015G017800 72 / 6e-16 AT5G53110 389 / 1e-134 RING/U-box superfamily protein (.1)
Potri.016G067900 70 / 6e-16 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1)
Potri.010G243200 68 / 3e-15 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1)
Potri.008G019000 68 / 3e-15 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1)
Potri.010G243500 67 / 4e-15 AT5G06490 113 / 6e-32 RING/U-box superfamily protein (.1)
Potri.001G435800 69 / 6e-15 AT3G20395 153 / 4e-46 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10036404 pacid=23174417 polypeptide=Lus10036404 locus=Lus10036404.g ID=Lus10036404.BGIv1.0 annot-version=v1.0
ATGACGAAGGACGCAACGGGGAGAATTCCGTCTCCGCCGTCGGCCTCGATCCGGCGGGGGTGCACCCACTTCCCACATCTCAGATTCCAATTCTCCAAGG
AGGCCGCGGCCGCGGCCTCCGGTGTTGGTAATAATAACGGCGTGGAAACGATGTGCTCGATCTGCCTGTGCGAGTACAAGGATCTGGAGATGATGAGGAT
GATGCCGGAGTGCCGCCATTACTTCCACCTGTGGTGTCTCGACGCTTGGCTGAAGCTCAACGGATCTTGCCCCGTCTGCCGGAACTCGCCGCTGCCGACT
CCGCTGTCCACGCCTCTCTCGGAGGTCGTGCCTCTGTCTCAGCATGCTGCTGATCGTAGAAGGAGGTAG
AA sequence
>Lus10036404 pacid=23174417 polypeptide=Lus10036404 locus=Lus10036404.g ID=Lus10036404.BGIv1.0 annot-version=v1.0
MTKDATGRIPSPPSASIRRGCTHFPHLRFQFSKEAAAAASGVGNNNGVETMCSICLCEYKDLEMMRMMPECRHYFHLWCLDAWLKLNGSCPVCRNSPLPT
PLSTPLSEVVPLSQHAADRRRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61550 RING/U-box superfamily protein... Lus10036404 0 1
AT3G61550 RING/U-box superfamily protein... Lus10041079 2.0 0.8690
AT1G09680 Pentatricopeptide repeat (PPR)... Lus10014170 3.5 0.8397
AT2G03690 coenzyme Q biosynthesis Coq4 f... Lus10026671 9.4 0.8659
AT4G05460 RNI-like superfamily protein (... Lus10038528 12.2 0.8041
AT2G21170 PDTPI, TIM PLASTID ISOFORM TRIOSE PHOSPHA... Lus10012171 13.5 0.8289
AT2G18840 Integral membrane Yip1 family ... Lus10025478 16.7 0.8456
AT5G42450 Pentatricopeptide repeat (PPR)... Lus10034408 16.9 0.7661
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10002853 18.4 0.8311
AT3G08640 Protein of unknown function (D... Lus10035607 18.8 0.8424
AT2G20690 lumazine-binding family protei... Lus10021323 19.0 0.8143

Lus10036404 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.