Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18840 77 / 2e-18 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G62890 76 / 5e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G66520 74 / 2e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G29760 71 / 4e-16 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G59200 70 / 6e-16 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G28660 69 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G40405 69 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G31430 69 / 2e-15 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G28640 67 / 4e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G37380 67 / 4e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041097 [exp] 128 / 1e-36 AT5G66520 367 / 2e-119 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031423 [exp] 78 / 8e-19 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010909 [exp] 76 / 4e-18 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026006 [exp] 72 / 1e-16 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010908 [exp] 72 / 1e-16 AT5G48910 410 / 5e-135 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002288 [exp] 72 / 1e-16 AT1G31430 689 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10023251 [exp] 72 / 1e-16 AT1G50270 525 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026886 [exp] 72 / 2e-16 AT2G44880 376 / 3e-124 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10027389 [exp] 72 / 2e-16 AT5G66520 393 / 7e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G106500 [exp] 105 / 1e-28 AT2G29760 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G071800 [exp] 78 / 8e-19 AT1G08070 606 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G237000 [exp] 77 / 1e-18 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G245300 [exp] 74 / 2e-17 AT3G22690 570 / 0.0 unknown protein Potri.005G012600 [exp] 73 / 4e-17 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G044700 [exp] 73 / 5e-17 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G252400 [exp] 72 / 8e-17 AT4G21065 496 / 8e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.003G088600 [exp] 71 / 2e-16 AT1G31430 690 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.017G141200 [exp] 71 / 4e-16 AT5G66520 407 / 1e-135 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G217600 [exp] 70 / 6e-16 AT1G05750 548 / 0.0 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036421 pacid=23174452 polypeptide=Lus10036421 locus=Lus10036421.g ID=Lus10036421.BGIv1.0 annot-version=v1.0 ATGGATAAGGTTGCTATAACCACTTTACTATCCGCTTGTGCAGGATTGGGAGCTTTGGAGCAAGGCTGCTGGCTTCACATGTACGTTGAAAAACAACGAA TCAAGGTCGATGCGCATCTATCCACGGCTTTGATCGACATGTACAGCAAATGTGGCCGAATCAACATGGCTAGAAAAGTGTTCAAATAA
AA sequence Show only first row Show all	>Lus10036421 pacid=23174452 polypeptide=Lus10036421 locus=Lus10036421.g ID=Lus10036421.BGIv1.0 annot-version=v1.0 MDKVAITTLLSACAGLGALEQGCWLHMYVEKQRIKVDAHLSTALIDMYSKCGRINMARKVFK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10036421 [exp]	0	1
AT4G18840			Pentatricopeptide repeat (PPR-...		Lus10036420 [exp]	1.0	0.9190
AT1G59720		CRR28	CHLORORESPIRATORY REDUCTION28,...		Lus10036422 [exp]	9.3	0.8458
					Lus10008385 [exp]	13.9	0.9006
					Lus10007184 [exp]	17.8	0.8900
					Lus10007226 [exp]	20.6	0.8900
AT1G49230			RING/U-box superfamily protein...		Lus10006786 [exp]	22.7	0.7479
AT2G28605			Photosystem II reaction center...		Lus10009159 [exp]	23.0	0.8900
					Lus10003536 [exp]	25.2	0.8900
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	27.2	0.8900
					Lus10009727 [exp]	29.1	0.8900

Compare expression of checked genes

Lus10036421 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.