Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45420 86 / 2e-21 MYB maMYB membrane anchored MYB, Duplicated homeodomain-like superfamily protein (.1) AT3G11450 56 / 2e-10 DnaJ domain ;Myb-like DNA-binding domain (.1) AT5G06110 51 / 9e-09 DnaJ domain ;Myb-like DNA-binding domain (.1.2) AT5G23650 39 / 0.0002 MYB Homeodomain-like transcriptional regulator (.1) AT5G08520 38 / 0.0004 MYB Duplicated homeodomain-like superfamily protein (.1) AT5G58900 38 / 0.0004 MYB Homeodomain-like transcriptional regulator (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018605 [exp] 122 / 2e-35 AT5G45420 247 / 7e-81 membrane anchored MYB, Duplicated homeodomain-like superfamily protein (.1) Lus10039841 [exp] 115 / 2e-32 AT5G45420 249 / 2e-81 membrane anchored MYB, Duplicated homeodomain-like superfamily protein (.1) Lus10034514 [exp] 54 / 1e-09 AT1G75660 968 / 0.0 5'-3' exoribonuclease 3 (.1) Lus10026920 [exp] 51 / 9e-09 AT5G06110 681 / 0.0 DnaJ domain ;Myb-like DNA-binding domain (.1.2) Lus10020117 [exp] 51 / 9e-09 AT5G06110 736 / 0.0 DnaJ domain ;Myb-like DNA-binding domain (.1.2) Lus10026919 [exp] 51 / 9e-09 AT5G06110 752 / 0.0 DnaJ domain ;Myb-like DNA-binding domain (.1.2) Lus10020118 [exp] 51 / 1e-08 AT5G06110 749 / 0.0 DnaJ domain ;Myb-like DNA-binding domain (.1.2) Lus10041001 [exp] 40 / 9e-05 AT5G08520 354 / 4e-123 Duplicated homeodomain-like superfamily protein (.1) Lus10018209 [exp] 40 / 0.0001 AT5G58900 302 / 9e-103 Homeodomain-like transcriptional regulator (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G147000 [exp] 93 / 4e-24 AT5G45420 234 / 1e-75 membrane anchored MYB, Duplicated homeodomain-like superfamily protein (.1) Potri.001G035800 [exp] 56 / 2e-10 AT3G11450 679 / 0.0 DnaJ domain ;Myb-like DNA-binding domain (.1) Potri.003G190000 [exp] 55 / 4e-10 AT3G11450 663 / 0.0 DnaJ domain ;Myb-like DNA-binding domain (.1) Potri.001G219100 [exp] 42 / 8e-06 AT5G04760 217 / 2e-71 Duplicated homeodomain-like superfamily protein (.1) Potri.007G076200 [exp] 40 / 4e-05 AT5G08520 293 / 6e-99 Duplicated homeodomain-like superfamily protein (.1) Potri.009G042600 [exp] 39 / 0.0002 AT5G58900 307 / 1e-104 Homeodomain-like transcriptional regulator (.1) Potri.005G087700 [exp] 38 / 0.0004 AT5G08520 304 / 2e-103 Duplicated homeodomain-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036429 pacid=23174649 polypeptide=Lus10036429 locus=Lus10036429.g ID=Lus10036429.BGIv1.0 annot-version=v1.0 ATGGGAGAGAAGAGATCGGACGACGGTGATTCGTATGCGAAGTTTTTTATGATGAACAGGAAGCCAGTGGACTCCAGAGTCGATGAGGCTGCTGAGGGGA CGGCCGAGGCTGCAGCCTCCGCCGACACATGGAGCTCCGGCGAGGATATTGCCTTGCTAAATGCTTTGAAGGCGTTCCCGAAAGAGGTGGCGATGAGGTG GGAGAAGATCGCGGCGGCTGTTCCGGGTAAGTCAAAGGCGGTTCCGGGTAAGTCAAATCTCAACAATGTCACTGTGAATCTGTGA
AA sequence Show only first row Show all	>Lus10036429 pacid=23174649 polypeptide=Lus10036429 locus=Lus10036429.g ID=Lus10036429.BGIv1.0 annot-version=v1.0 MGEKRSDDGDSYAKFFMMNRKPVDSRVDEAAEGTAEAAASADTWSSGEDIALLNALKAFPKEVAMRWEKIAAAVPGKSKAVPGKSNLNNVTVNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45420	MYB	maMYB	membrane anchored MYB, Duplica...		Lus10036429 [exp]	0	1
AT4G23470			PLAC8 family protein (.1.2.3)		Lus10018826 [exp]	1.4	0.8137
					Lus10002306 [exp]	7.9	0.7546
AT2G27710			60S acidic ribosomal protein f...		Lus10019846 [exp]	8.1	0.7739
AT5G17350			unknown protein		Lus10017620 [exp]	11.3	0.7578
AT1G69350			Tetratricopeptide repeat (TPR)...		Lus10009637 [exp]	23.0	0.6552
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028003 [exp]	27.9	0.7368
AT5G03450			Transducin/WD40 repeat-like su...		Lus10042191 [exp]	29.7	0.7772
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	30.2	0.7523
AT1G17530		ATTIM23-1	translocase of inner mitochond...		Lus10009183 [exp]	32.7	0.7536
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	40.3	0.7301

Compare expression of checked genes

Lus10036429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.