Lus10036432 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16470 151 / 7e-49 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
AT3G02790 150 / 1e-48 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041105 214 / 9e-74 AT3G02790 153 / 1e-49 zinc finger (C2H2 type) family protein (.1)
Lus10026839 166 / 2e-54 AT3G02790 146 / 1e-46 zinc finger (C2H2 type) family protein (.1)
Lus10020216 162 / 6e-53 AT3G02790 146 / 1e-46 zinc finger (C2H2 type) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G053500 162 / 6e-53 AT3G02790 160 / 2e-52 zinc finger (C2H2 type) family protein (.1)
Potri.013G086400 158 / 1e-51 AT3G02790 162 / 1e-53 zinc finger (C2H2 type) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10036432 pacid=23174617 polypeptide=Lus10036432 locus=Lus10036432.g ID=Lus10036432.BGIv1.0 annot-version=v1.0
ATGACTGGAAAAGCGAAGCCGAAGAAGCACACTGCCAAGGAGCTGGCCGCGAAGCTCGACGCTGCTACCACGAACCGGGGCGGGGGCAAAGCCGGAATAG
TAGATAGGACAGGCGGAGAAAAAGGTGGCCATTCCAAATTCGAGTGTCCGCTCTGTAAGGTGACTGCTCCTGACATCAAATCGATGCAGATCCATCACGA
TGCTCGCCATCCCAAGCTTCCCTTCGACGAAGCCAAGTGTTCCAATCTACACGCTACTCTGGTCACGGCGGCACCTGCTGAAACCTCCTCCTCCGGTAAG
GCGCGTCCTGGAGTCAGGGGAAGCCTCAAGAAGTGA
AA sequence
>Lus10036432 pacid=23174617 polypeptide=Lus10036432 locus=Lus10036432.g ID=Lus10036432.BGIv1.0 annot-version=v1.0
MTGKAKPKKHTAKELAAKLDAATTNRGGGKAGIVDRTGGEKGGHSKFECPLCKVTAPDIKSMQIHHDARHPKLPFDEAKCSNLHATLVTAAPAETSSSGK
ARPGVRGSLKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02790 C2H2ZnF zinc finger (C2H2 type) family... Lus10036432 0 1
AT3G58680 MBF1B, ATMBF1B multiprotein bridging factor 1... Lus10013686 2.4 0.9253
AT5G47870 RAD52-2B, RAD52... radiation sensitive 51-2, unkn... Lus10002565 3.2 0.9311
AT1G33520 MOS2 modifier of snc1, 2, D111/G-pa... Lus10004607 3.7 0.9034
AT5G19910 MED31 SOH1 family protein (.1.2) Lus10016131 4.5 0.9177
AT3G56490 HIT3, HINT1 HISTIDINE TRIAD NUCLEOTIDE-BIN... Lus10035409 4.5 0.9185
AT5G53800 unknown protein Lus10003591 4.6 0.9161
AT1G08830 CSD1 copper/zinc superoxide dismuta... Lus10004139 5.5 0.9263
AT4G27000 ATRBP45C RNA-binding (RRM/RBD/RNP motif... Lus10043106 6.6 0.8794
AT1G77180 SKIP chromatin protein family (.1.2... Lus10027158 8.1 0.8951
AT1G31870 unknown protein Lus10033140 8.5 0.9025

Lus10036432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.