Lus10036433 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041106 272 / 4e-93 AT5G16490 61 / 2e-11 ROP-interactive CRIB motif-containing protein 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G086600 51 / 4e-08 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.019G053300 49 / 3e-07 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10036433 pacid=23174436 polypeptide=Lus10036433 locus=Lus10036433.g ID=Lus10036433.BGIv1.0 annot-version=v1.0
ATGAGGGCAGGCAGAAGAATGGAGCGTCTGGTACTGCTTCCATTCACCATCGGCTGCGTCTCCGAGTCCAGCATCGCCATCGCCAACCACCACCACATCC
ACCACCCCAGATCGAGATCGAGATCATCTTCGTCGAATCCTCTTACCACCACCAAGAACAACAACAAATCCCCTCCACAATCAACAATCAGAAAGAGGTT
AGAAGACGACGATCATAGCCTATCCAGTAACGACGACGACACCAAACTGCCCATCAGCAACATATCAGCCGGTTTCCATCGGTTTCTCAAATCTTTCAAG
TCTACTTTCGTGAACAATGGAGATGACGAAGAAGAAGAAATGGAAGAGGAAGGGATCATGGAGATAGGGCTTCCAACAGATGTAAAGCACGTAACCCACA
TTGGGTTTGATGATCATGAAGCAATCTCGTCCTCTTCATCGTCGTCAGCATCATTGCACTCGACTGGAGTCGATCAGCGGCCATCGATTCTTTGTCAATG
CGGCGGTTGGGAGAATCTGAGTGGTCCACAATCTCATAATCATCATCGCCAGCTCCTCTGTCTTCATCATTCTTCTTCTTCTTTTGTAAGGCCGGAGCAG
CTTCCTCTTGCTTCCCCGGGGGCATCCGATCCAGTACATTCGGTCTTTCCCACTTCATCCTGA
AA sequence
>Lus10036433 pacid=23174436 polypeptide=Lus10036433 locus=Lus10036433.g ID=Lus10036433.BGIv1.0 annot-version=v1.0
MRAGRRMERLVLLPFTIGCVSESSIAIANHHHIHHPRSRSRSSSSNPLTTTKNNNKSPPQSTIRKRLEDDDHSLSSNDDDTKLPISNISAGFHRFLKSFK
STFVNNGDDEEEEMEEEGIMEIGLPTDVKHVTHIGFDDHEAISSSSSSSASLHSTGVDQRPSILCQCGGWENLSGPQSHNHHRQLLCLHHSSSSFVRPEQ
LPLASPGASDPVHSVFPTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16490 RIC4 ROP-interactive CRIB motif-con... Lus10036433 0 1
AT5G16490 RIC4 ROP-interactive CRIB motif-con... Lus10041106 1.0 0.9915
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10035517 2.4 0.9903
AT1G11655 unknown protein Lus10020050 2.4 0.9814
AT3G18660 PGSIP1, GUX1 glucuronic acid substitution o... Lus10020890 3.0 0.9871
AT2G36880 MAT3 methionine adenosyltransferase... Lus10013828 3.9 0.9818
AT2G17940 Plant protein of unknown funct... Lus10041916 4.0 0.9821
AT4G33330 PGSIP3, GUX2 glucuronic acid substitution o... Lus10042658 5.3 0.9795
AT1G60810 ACLA-2 ATP-citrate lyase A-2 (.1) Lus10030592 5.8 0.9760
AT2G36880 MAT3 methionine adenosyltransferase... Lus10026541 7.3 0.9783
AT3G50760 GATL2 galacturonosyltransferase-like... Lus10010790 7.5 0.9751

Lus10036433 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.