Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09630 363 / 5e-129 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT3G46830 306 / 9e-107 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT1G07410 306 / 1e-106 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT5G59150 299 / 6e-104 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT5G60860 284 / 5e-98 AtRABA1f RAB GTPase homolog A1F (.1) AT3G15060 280 / 2e-96 AtRABA1g RAB GTPase homolog A1G (.1) AT5G45750 276 / 7e-95 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18800 276 / 1e-94 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT1G16920 276 / 1e-94 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT4G18430 272 / 3e-93 AtRABA1e RAB GTPase homolog A1E (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041116 [exp] 384 / 3e-137 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10016486 [exp] 308 / 1e-107 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040745 [exp] 308 / 3e-107 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040255 [exp] 300 / 4e-104 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10004687 [exp] 299 / 6e-104 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10001026 [exp] 297 / 3e-103 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10015297 [exp] 284 / 6e-98 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 283 / 1e-97 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10017679 [exp] 283 / 2e-97 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G004100 [exp] 347 / 6e-123 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.006G000300 [exp] 310 / 2e-108 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 309 / 1e-107 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 303 / 1e-105 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.004G226400 [exp] 297 / 3e-103 AT1G09630 331 / 7e-117 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.008G061300 [exp] 297 / 3e-103 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.011G061300 [exp] 283 / 1e-97 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.011G070300 [exp] 281 / 8e-97 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.001G374000 [exp] 279 / 6e-96 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 278 / 1e-95 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10036441 pacid=23174593 polypeptide=Lus10036441 locus=Lus10036441.g ID=Lus10036441.BGIv1.0 annot-version=v1.0 ATGTCGAGGAGGCCGGACGAAGAGTACGACTACCTGTTCAAGGTCGTCTTAATCGGCGATTCCGGCGTCGGAAAATCAAACCTCCTCTCTCGCCTCACTC GTAACGAGTTCTGCCTAGAGTCCAAGTCCACCAACGACGGTCAAAAGTCCACAATTGGCGTCGAATTCGCCACCCGCACCCTCCAAGTGGAAGGAAGGGT GGTGAAAGCTCAGATATGGGACACAGCAGGCCAGGAAAGGTACAGAGCCATAACCAGTGCCTACTACAGGGGTGCCCTGGGAGCACTTCTAGTGTACGAC GTTACAAAGCCAACAACGTTCGAGAACGTTAGCCGGTGGCTCAAGGAACTGAGGGACCATGCGGATGCCAACATTGTGGTGATGCTAATTGGGAACAAGA CCGATCTGAAGCATCTGAGAGGCGTTGCCACCGAGGATGCGCAGGGCTATGCAGAGAAAGAAGGGTTGTCGTTCATCGAGACATCTGCACTCGAGGCTCT GAATGTGGAGAAGGCTTTCCAAACTATCTTGTCAGAGATTTACCGTATAATAAGCAAGAAGTCTCTGTCGTCTTCGGGAGAGGGAGAGGATTCGGGGAGT GTGAAGGAAGGGAAGACCATTGTTGTTGAAGACTCGGAAGGGGTGAATGCAAAGAAACCTTGCTGTAGTTCATCTTAG
AA sequence Show only first row Show all	>Lus10036441 pacid=23174593 polypeptide=Lus10036441 locus=Lus10036441.g ID=Lus10036441.BGIv1.0 annot-version=v1.0 MSRRPDEEYDYLFKVVLIGDSGVGKSNLLSRLTRNEFCLESKSTNDGQKSTIGVEFATRTLQVEGRVVKAQIWDTAGQERYRAITSAYYRGALGALLVYD VTKPTTFENVSRWLKELRDHADANIVVMLIGNKTDLKHLRGVATEDAQGYAEKEGLSFIETSALEALNVEKAFQTILSEIYRIISKKSLSSSGEGEDSGS VKEGKTIVVEDSEGVNAKKPCCSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09630		ATRAB-A2A, ATRA...	ARABIDOPSIS RAB GTPASE A2A, RA...		Lus10036441 [exp]	0	1
AT3G50360		CEN1, ATCEN2	CENTRIN 1, centrin2 (.1)		Lus10003320 [exp]	4.1	0.7178
AT1G15220		ATCCMH	cytochrome c biogenesis protei...		Lus10038941 [exp]	6.3	0.6511
AT3G42150			unknown protein		Lus10011614 [exp]	8.1	0.6827
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Lus10030786 [exp]	23.2	0.6819
AT5G52880			F-box family protein (.1)		Lus10027547 [exp]	25.0	0.6793
AT5G22920			CHY-type/CTCHY-type/RING-type ...		Lus10023914 [exp]	35.2	0.6497
AT5G59613			unknown protein		Lus10040848 [exp]	46.3	0.6196
AT1G16000			unknown protein		Lus10023116 [exp]	100.6	0.6000
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Lus10007216 [exp]	111.5	0.5887
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10012570 [exp]	168.0	0.5859

Compare expression of checked genes

Lus10036441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.