Lus10036450 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 172 / 9e-50 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 138 / 5e-37 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 132 / 8e-35 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 114 / 3e-28 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61980 110 / 1e-26 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 103 / 2e-24 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 103 / 2e-24 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 102 / 9e-24 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 100 / 4e-23 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 88 / 8e-19 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041122 582 / 0 AT5G07900 166 / 2e-47 Mitochondrial transcription termination factor family protein (.1)
Lus10008688 184 / 1e-54 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 169 / 1e-48 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 162 / 4e-46 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 146 / 3e-40 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10004329 137 / 7e-37 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 131 / 2e-34 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10028912 129 / 1e-33 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 115 / 2e-29 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034700 186 / 4e-55 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 176 / 2e-51 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 174 / 7e-51 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034500 171 / 1e-49 AT5G07900 208 / 2e-63 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035200 170 / 2e-49 AT5G07900 168 / 3e-48 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034600 168 / 2e-48 AT5G07900 197 / 4e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.003G189300 168 / 2e-48 AT5G07900 178 / 6e-52 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190300 164 / 7e-47 AT5G07900 209 / 8e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035000 161 / 1e-45 AT5G07900 209 / 7e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190700 159 / 3e-45 AT5G07900 213 / 3e-65 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10036450 pacid=23174385 polypeptide=Lus10036450 locus=Lus10036450.g ID=Lus10036450.BGIv1.0 annot-version=v1.0
ATGGCTCTTTCAATCCGCAAGTCTCTCTTATCATTATATCTAAGGTCGCCGTCCTTTACCGACACTAGCTCATTCTTCTTCTCAACCCTCAAAACCACAA
AATCCAAATCCAAATCCAAATACAAATCCAAAATCTCAGTCTTTGATTACTTAGTCAACCAGCAGCAGTTCTCTCCTGACAGAGCCGCCAAAGCCTTATC
AGTCGCAGTCGTCAAGAACCTGAAGAACCCTCAAAACGCCGATTCCGTACTATCATACCTAACCGCCGTCGGATTCTCCCGCTCCCAGATCGAAACCGTC
GTCCAAAAGGTCCCTCGAGTCCTCTCCTCCGACATCGACAACGTTCTAAAACCTAAAGTCGAAGTCTTCTCCGATTCAGGATTCAAACCAAAAGACATGA
CGGAGATCATCACCGGAGATCCATGGATCCTAACCAGAAGCTCAGTCAACAGCTTAGCTCCTTCAGTAGAAGTATTAAAGAGCGTAGTCGGATCAGTCTC
CGATGTAGCCGCATTGTTGAAGAAATCCGCTTGGTTCTTAAAACAGGATCTGAAAGCAACATTTCTCCCCAACGTCGAATACGCCCAATCATTAGGACTT
ACTCACGAGAAGATACTCCGATTCGTGTCGAACTTCCCTCGATTCTTCCTCCTCAAGCCCGAGCTAGTCAAGGAATTTGCTCGAAAGGTCGAAGAGATGG
GACTCGACAAGGAATCCACGATGTTTTTATACGCTGTTCGTGTTGTGGGCTCGATGAGTCCCAAAAGATGGGAGGACAAGCTGAATCTGCTACGAGAGCT
CGGATTCTCCGAGGAAGATATTGTGTTTGCGTTCAAGAGGCATCCGATGGCCTTCTCGACATCAGATAGGAAGGTGAAGGAAGTGGTGGAGTTCTTGGTG
AGCGAGACTGATCTCGACATACAGAGCATTGTGAAGTCTCCGCAGTTGCTGCTGTTTAGTATCGAGAATCGGATTAAGCCGAGGCTGATGGTTATAAAGG
CTTTGCAGGAGAAGAACCTGGTACCAGCGATTAATATGTTGAATGTTTACAAGATGGGACATATTCCGTTCTCGAAGAGGTATGTGTTTCCGTACTTGGA
GAAGGTTGATGGCTTGTTAAGGCTAGCTGCTGGGGAATAG
AA sequence
>Lus10036450 pacid=23174385 polypeptide=Lus10036450 locus=Lus10036450.g ID=Lus10036450.BGIv1.0 annot-version=v1.0
MALSIRKSLLSLYLRSPSFTDTSSFFFSTLKTTKSKSKSKYKSKISVFDYLVNQQQFSPDRAAKALSVAVVKNLKNPQNADSVLSYLTAVGFSRSQIETV
VQKVPRVLSSDIDNVLKPKVEVFSDSGFKPKDMTEIITGDPWILTRSSVNSLAPSVEVLKSVVGSVSDVAALLKKSAWFLKQDLKATFLPNVEYAQSLGL
THEKILRFVSNFPRFFLLKPELVKEFARKVEEMGLDKESTMFLYAVRVVGSMSPKRWEDKLNLLRELGFSEEDIVFAFKRHPMAFSTSDRKVKEVVEFLV
SETDLDIQSIVKSPQLLLFSIENRIKPRLMVIKALQEKNLVPAINMLNVYKMGHIPFSKRYVFPYLEKVDGLLRLAAGE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10036450 0 1
AT5G03070 IMPA-9 importin alpha isoform 9 (.1) Lus10008480 8.0 0.8702
AT1G09760 U2A' U2 small nuclear ribonucleopro... Lus10028659 8.8 0.8961
AT1G06220 GFA1, CLO, MEE5 MATERNAL EFFECT EMBRYO ARREST ... Lus10043478 10.4 0.8944
AT4G10710 SPT16 global transcription factor C ... Lus10039410 13.9 0.8890
AT1G61580 RPL3B, ARP2 ARABIDOPSIS RIBOSOMAL PROTEIN ... Lus10037360 22.3 0.8929
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10038908 28.0 0.8913
AT4G01560 MEE49 maternal effect embryo arrest ... Lus10030171 29.0 0.8884
AT1G77720 PPK1 putative protein kinase 1 (.1) Lus10025634 30.0 0.8859
AT5G11300 CYC2BAT, CYCA2;... CYCLIN A2;2, mitotic-like cycl... Lus10008103 31.5 0.8860
AT2G31610 Ribosomal protein S3 family pr... Lus10012857 32.3 0.8918

Lus10036450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.