Plant FIBer expression Database

Lus10036473 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22275 85 / 1e-19 ZYP1b Myosin heavy chain-related protein (.1)
AT1G22260 84 / 3e-19 AtZYP1a, ZYP1a Myosin heavy chain-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036517
[exp]
258 / 1e-81 AT1G22260 663 / 0.0 Myosin heavy chain-related protein (.1)
Lus10041143
[exp]
249 / 6e-80 AT1G22260 451 / 8e-148 Myosin heavy chain-related protein (.1)
Lus10032798
[exp]
216 / 2e-66 AT1G22260 575 / 0.0 Myosin heavy chain-related protein (.1)
Lus10010242
[exp]
134 / 9e-37 AT1G22275 279 / 5e-83 Myosin heavy chain-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G096400
[exp]
96 / 2e-23 AT1G22275 786 / 0.0 Myosin heavy chain-related protein (.1)
PFAM info
Representative CDS sequence
>Lus10036473 pacid=23174381 polypeptide=Lus10036473 locus=Lus10036473.g ID=Lus10036473.BGIv1.0 annot-version=v1.0
ATGGATGTAGGCGGGAAGGAGTTGATGGATCTTAGAGCTGAAGCTAAGGAAAACTGCGATGTCTTTGCAGAAGAGAAGTGCAGACTGACTAACCTAATTG
GGGAAAAAGATGGGCAGAGGGCTTTGCTGCAGATGCAGAGGAAAGTGATGAGTGACAAACAAGATAATAATGATGCAGAAGTGAACTCTAAACAGGTCCC
GTCGAATTCATCTGTCCAGATGTTAGAACCCAGAACTCGTAAAAGTCCAAGATCGCTGTCAAGACCAGACTATGGTAAGACAGGATCTGTAATGCCGACC
CCCGTGCATTCGAGAAAGGTTACCCGTCCTGAATACGAGGTTGAACGTGGCGATGGTAAGTCAATCTCGAAACGGAGAAAGACAAGAAATACGGCCTTGC
ACGAGAGAGCCATGGGAGCTACCCAACAGGGTCCGTCCAACATTGGAGATCTCTTCTCAGAAGGCTGGCTCAATCCATATGAAGATGATCCCTACGGTTT
CAAGTAG
AA sequence
>Lus10036473 pacid=23174381 polypeptide=Lus10036473 locus=Lus10036473.g ID=Lus10036473.BGIv1.0 annot-version=v1.0
MDVGGKELMDLRAEAKENCDVFAEEKCRLTNLIGEKDGQRALLQMQRKVMSDKQDNNDAEVNSKQVPSNSSVQMLEPRTRKSPRSLSRPDYGKTGSVMPT
PVHSRKVTRPEYEVERGDGKSISKRRKTRNTALHERAMGATQQGPSNIGDLFSEGWLNPYEDDPYGFK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22275 ZYP1b Myosin heavy chain-related pro... Lus10036473
[exp]
0 1
AT1G19835 Plant protein of unknown funct... Lus10034509
[exp]
13.1 0.8114
AT2G20800 NDB4 NAD(P)H dehydrogenase B4 (.1) Lus10018540
[exp]
14.9 0.7641
Lus10002716
[exp]
15.8 0.8106
AT2G40460 Major facilitator superfamily ... Lus10034206
[exp]
19.0 0.7684
AT5G58160 actin binding (.1) Lus10024450
[exp]
20.4 0.7722
AT1G72200 RING/U-box superfamily protein... Lus10029794
[exp]
20.6 0.7342
Lus10042801
[exp]
28.3 0.7730
AT2G41820 Leucine-rich repeat protein ki... Lus10007543
[exp]
32.8 0.7578
AT5G47400 unknown protein Lus10007801
[exp]
34.9 0.7819
AT3G33530 Transducin family protein / WD... Lus10019403
[exp]
37.5 0.7924

Lus10036473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.