Lus10036478 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22450 141 / 3e-44 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
AT4G28060 134 / 4e-43 Cytochrome c oxidase, subunit Vib family protein (.1)
AT5G57815 134 / 8e-43 Cytochrome c oxidase, subunit Vib family protein (.1)
AT1G32710 71 / 3e-17 Cytochrome c oxidase, subunit Vib family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010345 154 / 1e-50 AT1G22450 142 / 4e-46 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Lus10008716 142 / 9e-45 AT1G22450 173 / 4e-55 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Lus10040123 113 / 6e-34 AT1G22450 121 / 9e-36 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Lus10020941 108 / 6e-31 AT1G22450 138 / 9e-41 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G162100 144 / 2e-45 AT1G22450 152 / 4e-47 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Potri.018G099900 140 / 2e-45 AT5G57815 147 / 3e-48 Cytochrome c oxidase, subunit Vib family protein (.1)
Potri.002G100000 112 / 6e-33 AT1G22450 123 / 2e-35 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0351 CHCH PF02297 COX6B Cytochrome oxidase c subunit VIb
Representative CDS sequence
>Lus10036478 pacid=23174394 polypeptide=Lus10036478 locus=Lus10036478.g ID=Lus10036478.BGIv1.0 annot-version=v1.0
ATGGCTGATCTTGCCACCGCTGACGCTCTCTCCTCTCTCGAGCTGAAGACAGCACCAGCTGATTACCGTTTCCCGACGACCAACCAAACAAGGCACTGCT
TTACTCGTTACATTGAGTTCCATAGGTGCGTTGCTGCAAAGGGAGACGATGCTTCAGACTGCCAGAAGTTCTCCAAATACTATCGCTCTCTTTGTCCTGG
TGAATGGGTGGAGAAATGGAATGAGCAGAGGGAGAATGGTACGTTTGCAGGACCTCTGTAG
AA sequence
>Lus10036478 pacid=23174394 polypeptide=Lus10036478 locus=Lus10036478.g ID=Lus10036478.BGIv1.0 annot-version=v1.0
MADLATADALSSLELKTAPADYRFPTTNQTRHCFTRYIEFHRCVAAKGDDASDCQKFSKYYRSLCPGEWVEKWNEQRENGTFAGPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22450 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cyto... Lus10036478 0 1
AT1G22450 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cyto... Lus10010345 4.9 0.8422
AT1G73177 APC13, BNS anaphase-promoting complex 13,... Lus10007286 13.3 0.8462
AT5G20090 Uncharacterised protein family... Lus10025851 13.6 0.8516
AT3G49870 ATARLA1C ADP-ribosylation factor-like A... Lus10019259 15.1 0.8455
AT3G49870 ATARLA1C ADP-ribosylation factor-like A... Lus10011545 18.5 0.7952
AT1G54120 unknown protein Lus10013152 20.1 0.8292
AT4G39660 AGT2 alanine:glyoxylate aminotransf... Lus10029922 23.2 0.8057
AT2G44610 RAB6, AtRABH1b,... Ras-related small GTP-binding ... Lus10019501 24.0 0.8010
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Lus10024423 24.4 0.8295
AT5G61310 Cytochrome c oxidase subunit V... Lus10010008 25.7 0.8142

Lus10036478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.