Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45190 155 / 1e-47 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 140 / 6e-42 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2) AT2G26580 108 / 4e-30 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT1G08465 109 / 5e-30 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT1G69180 81 / 6e-19 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) AT1G23420 80 / 2e-18 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010361 [exp] 193 / 7e-62 AT2G45190 171 / 4e-53 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10032240 [exp] 122 / 1e-34 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 122 / 2e-34 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10019407 [exp] 104 / 5e-28 AT2G26580 228 / 8e-77 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10029135 [exp] 83 / 2e-19 AT1G23420 200 / 9e-65 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10013028 [exp] 81 / 1e-18 AT1G23420 193 / 4e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10030596 [exp] 81 / 3e-18 AT1G23420 194 / 8e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10008374 [exp] 79 / 3e-18 AT1G08465 84 / 9e-21 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Lus10036811 [exp] 77 / 1e-17 AT1G69180 187 / 4e-61 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G066700 [exp] 163 / 9e-51 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.002G145100 [exp] 150 / 6e-46 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.003G112800 [exp] 147 / 2e-44 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.001G120200 [exp] 145 / 7e-44 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.009G000100 [exp] 108 / 5e-30 AT1G08465 215 / 3e-72 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.006G067800 [exp] 108 / 8e-30 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.001G214700 [exp] 108 / 1e-29 AT1G08465 183 / 8e-59 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.018G129800 [exp] 103 / 7e-28 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.016G067300 [exp] 86 / 2e-21 AT1G08465 150 / 2e-46 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.010G042400 [exp] 85 / 2e-20 AT1G23420 191 / 3e-61 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF04690 [flax] [poplar] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Lus10036496 pacid=23174404 polypeptide=Lus10036496 locus=Lus10036496.g ID=Lus10036496.BGIv1.0 annot-version=v1.0 ATGCGTGGTCTCCTCCTCCCGGCCGCCGCCACCTCAGCCGCTGCCGCTACTAGCCAGCTTCACCTCGGCCACCCCTTCTTCACCCCTCACAACCTCCTTG AGGACATGAGGAGCACTTCAGCACCGTCGCTGATGATGAACAACAACGGCGGCGGAAACAACAACCACCAGCATCATCAGCATCAGCAGATGGGATTGAA CGACCTCGTATCATCGCCGTTTATGCCAATCCGTGGAGGTGGAAGCGGCGGCGGCGGAGGAACCATGGGGTTAGGGTTTGAGGACACTACTCCCAAGCCG CCTCCTGTTAACCGACCTCCAGAGAAGAGACAGAGAGTCCCTTCTGCTTACAACCGCTTCATCAAGGACGAGATCCAACGCATAAAGGCAGGGAATCCAG ACATAAGCCACAGGGAGGCTTTCAGTGCAGCTGCCAAGAATTGGGCTCATTTCCCACACATCCACTTTGGACTCATGCCTGATAATCAGCCCGGGAAGAA ACCTAATCTCCTCCAGCAGGAAGCAGAAGATCAGATGGGACTGATCAAAGATGGGTTCTTCCCTCCAGCCAATCTTGGTGTTACACCCTACTGA
AA sequence Show only first row Show all	>Lus10036496 pacid=23174404 polypeptide=Lus10036496 locus=Lus10036496.g ID=Lus10036496.BGIv1.0 annot-version=v1.0 MRGLLLPAAATSAAAATSQLHLGHPFFTPHNLLEDMRSTSAPSLMMNNNGGGNNNHQHHQHQQMGLNDLVSSPFMPIRGGGSGGGGGTMGLGFEDTTPKP PPVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQPGKKPNLLQQEAEDQMGLIKDGFFPPANLGVTPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45190	YABBY	FIL, YAB1, AFO	YABBY1, FILAMENTOUS FLOWER, AB...		Lus10036496 [exp]	0	1
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10018520 [exp]	1.0	0.9813
AT3G49950	GRAS		GRAS family transcription fact...		Lus10018498 [exp]	2.0	0.9634
AT3G25670			Leucine-rich repeat (LRR) fami...		Lus10027239 [exp]	3.0	0.9537
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10031608 [exp]	3.2	0.9712
AT3G05470			Actin-binding FH2 (formin homo...		Lus10004505 [exp]	3.5	0.9643
AT2G26580	YABBY	YAB5	YABBY5, plant-specific transcr...		Lus10030105 [exp]	3.7	0.9581
AT2G45190	YABBY	FIL, YAB1, AFO	YABBY1, FILAMENTOUS FLOWER, AB...		Lus10010361 [exp]	5.0	0.9628
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10009336 [exp]	5.5	0.9354
AT2G28470		BGAL8	beta-galactosidase 8 (.1.2)		Lus10006733 [exp]	5.7	0.9542
AT5G51560			Leucine-rich repeat protein ki...		Lus10031702 [exp]	5.7	0.9504

Compare expression of checked genes

Lus10036496 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.