Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51960 98 / 3e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041422 [exp] 148 / 5e-48 AT5G51960 145 / 2e-46 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G044200 [exp] 112 / 3e-34 AT5G51960 144 / 4e-46 unknown protein Potri.010G217300 [exp] 103 / 9e-31 AT5G51960 130 / 7e-41 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036504 pacid=23174432 polypeptide=Lus10036504 locus=Lus10036504.g ID=Lus10036504.BGIv1.0 annot-version=v1.0 ATGAAGGTTACACGGGAGTTCAGGAAGAGCTCTAATGTTCTTCCAACAGACAAACCATCATGCATCCAGCAGAAAATCAAGCTTGCCCGGGACTACACTT ACCTGCGCAACAGTGTTCACCATCACAAAGATCTTCTGATTTCTTACAATATAGCAGTGGACAGATCCAATGAAATGAGCAAAGTGCTAGGGAAGTCTGC AGCAAGTGTTGGTCTTCAGCTTCCTGATGTGTATCAGCCTTGA
AA sequence Show only first row Show all	>Lus10036504 pacid=23174432 polypeptide=Lus10036504 locus=Lus10036504.g ID=Lus10036504.BGIv1.0 annot-version=v1.0 MKVTREFRKSSNVLPTDKPSCIQQKIKLARDYTYLRNSVHHHKDLLISYNIAVDRSNEMSKVLGKSAASVGLQLPDVYQP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51960			unknown protein		Lus10036504 [exp]	0	1
AT4G21192			Cytochrome c oxidase biogenesi...		Lus10019246 [exp]	2.8	0.8636
AT1G55340			Protein of unknown function (D...		Lus10010312 [exp]	2.8	0.8640
AT3G09890			Ankyrin repeat family protein ...		Lus10014410 [exp]	6.6	0.8476
AT5G62980		FOLB2	Dihydroneopterin aldolase (.1)		Lus10021252 [exp]	6.9	0.8528
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10023313 [exp]	7.1	0.8458
AT5G19670			Exostosin family protein (.1)		Lus10011121 [exp]	10.5	0.8202
AT5G52545			unknown protein		Lus10014958 [exp]	10.6	0.8420
AT3G11591			unknown protein		Lus10016986 [exp]	12.6	0.8272
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008023 [exp]	15.4	0.8270
AT3G46020			RNA-binding (RRM/RBD/RNP motif...		Lus10040854 [exp]	17.0	0.8439

Compare expression of checked genes

Lus10036504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.