Lus10036507 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35795 142 / 5e-45 Chaperone DnaJ-domain superfamily protein (.1)
AT3G09700 137 / 1e-42 Chaperone DnaJ-domain superfamily protein (.1)
AT5G03030 136 / 1e-42 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041420 162 / 4e-52 AT2G35795 194 / 2e-65 Chaperone DnaJ-domain superfamily protein (.1)
Lus10040376 149 / 2e-44 AT5G03030 184 / 6e-58 Chaperone DnaJ-domain superfamily protein (.1)
Lus10023494 112 / 1e-33 AT5G03030 135 / 3e-43 Chaperone DnaJ-domain superfamily protein (.1)
Lus10015065 87 / 4e-23 AT2G35795 118 / 3e-36 Chaperone DnaJ-domain superfamily protein (.1)
Lus10019915 91 / 5e-22 AT5G28540 321 / 2e-101 heat shock protein 70 (Hsp 70) family protein (.1)
Lus10026485 80 / 4e-19 AT1G09080 124 / 2e-36 binding protein 3, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G131200 143 / 2e-45 AT2G35795 195 / 2e-66 Chaperone DnaJ-domain superfamily protein (.1)
Potri.008G043500 142 / 5e-45 AT2G35795 179 / 4e-60 Chaperone DnaJ-domain superfamily protein (.1)
Potri.012G038800 116 / 1e-34 AT2G35795 160 / 3e-52 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Lus10036507 pacid=23174449 polypeptide=Lus10036507 locus=Lus10036507.g ID=Lus10036507.BGIv1.0 annot-version=v1.0
ATGCAGGCATCACGATGTGGCTGTAGTTTAGTGGCTACACCTTTCTTGGCTGGAGTTGCAGTTGCAGCTGCTGCTCTTGGAGGAAGATACGGAATCCAGG
CATGGCAAGCATTCAAGGCTCGTCCACCGAAAATGCGTAGATTCTACGATGGTGGATTCCAGGCTAAGATGCCAGGAGAGAGGCCGCTCTTATTCTTGTT
AAAATCAGTTGGAAGCGAATGGATGATAGTGTTGATGTTATTCGACAGGGAAAGTGCGACAGCGGAGAAGGTGAAGGAAGCGCATAGAAGAGTAATGGTA
GCAAACCATCCAGATGCAGGTGGTAGCCATTACCTAGCTTCCAAGATCAATGAAGCCAAAGATGTGATGCTAGGAAAGACTAAGGGGACTGGTTCTGCTT
TCTGA
AA sequence
>Lus10036507 pacid=23174449 polypeptide=Lus10036507 locus=Lus10036507.g ID=Lus10036507.BGIv1.0 annot-version=v1.0
MQASRCGCSLVATPFLAGVAVAAAALGGRYGIQAWQAFKARPPKMRRFYDGGFQAKMPGERPLLFLLKSVGSEWMIVLMLFDRESATAEKVKEAHRRVMV
ANHPDAGGSHYLASKINEAKDVMLGKTKGTGSAF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G35795 Chaperone DnaJ-domain superfam... Lus10036507 0 1
AT3G07940 Calcium-dependent ARF-type GTP... Lus10016347 1.7 0.7884
AT2G41530 ATSFGH ARABIDOPSIS THALIANA S-FORMYLG... Lus10035437 10.1 0.7664
AT4G38900 bZIP AtbZIP29 Basic-leucine zipper (bZIP) tr... Lus10000069 12.5 0.7008
AT4G28600 NPGR2 no pollen germination related ... Lus10011793 12.8 0.7603
AT3G24550 ATPERK1 proline-rich extensin-like rec... Lus10014319 14.8 0.7293
AT2G36410 Family of unknown function (DU... Lus10023876 18.0 0.7614
AT5G66200 ARO2 armadillo repeat only 2 (.1) Lus10036897 25.2 0.7248
AT1G04760 ATVAMP726 vesicle-associated membrane pr... Lus10043133 25.8 0.7465
AT4G07990 Chaperone DnaJ-domain superfam... Lus10012482 28.0 0.7543
AT5G63905 unknown protein Lus10007744 28.6 0.7243

Lus10036507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.