Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45590 114 / 5e-31 Protein kinase superfamily protein (.1) AT4G25390 91 / 1e-22 Protein kinase superfamily protein (.1.2) AT5G51770 82 / 2e-19 Protein kinase superfamily protein (.1) AT1G80870 73 / 2e-16 Protein kinase superfamily protein (.1) AT5G07280 57 / 1e-10 EXS, EMS1 EXTRA SPOROGENOUS CELLS, EXCESS MICROSPOROCYTES1, Leucine-rich repeat transmembrane protein kinase (.1) AT1G29720 56 / 3e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53440 56 / 4e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53420 56 / 5e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT4G23290 55 / 6e-10 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) AT1G53430 55 / 6e-10 Leucine-rich repeat transmembrane protein kinase (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041395 [exp] 146 / 3e-42 AT2G45590 647 / 0.0 Protein kinase superfamily protein (.1) Lus10031678 [exp] 93 / 9e-24 AT2G45590 263 / 6e-83 Protein kinase superfamily protein (.1) Lus10027393 [exp] 94 / 1e-23 AT4G25390 555 / 0.0 Protein kinase superfamily protein (.1.2) Lus10026069 [exp] 69 / 6e-15 AT1G80870 646 / 0.0 Protein kinase superfamily protein (.1) Lus10014361 [exp] 67 / 4e-14 AT1G80870 580 / 0.0 Protein kinase superfamily protein (.1) Lus10031374 [exp] 54 / 2e-09 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10039731 [exp] 53 / 3e-09 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10031199 [exp] 53 / 4e-09 AT1G56130 1261 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10041680 [exp] 52 / 5e-09 AT1G15520 1646 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G072900 [exp] 125 / 7e-35 AT2G45590 576 / 0.0 Protein kinase superfamily protein (.1) Potri.002G150800 [exp] 123 / 6e-34 AT2G45590 563 / 0.0 Protein kinase superfamily protein (.1) Potri.012G131900 [exp] 101 / 2e-26 AT4G25390 486 / 5e-164 Protein kinase superfamily protein (.1.2) Potri.015G134100 [exp] 101 / 3e-26 AT4G25390 536 / 0.0 Protein kinase superfamily protein (.1.2) Potri.001G043700 [exp] 76 / 3e-17 AT1G80870 721 / 0.0 Protein kinase superfamily protein (.1) Potri.003G183100 [exp] 75 / 7e-17 AT1G80870 786 / 0.0 Protein kinase superfamily protein (.1) Potri.001G082900 [exp] 67 / 3e-14 AT1G56140 1097 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.001G308600 [exp] 63 / 8e-13 AT1G07650 912 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.003G148000 [exp] 60 / 1e-11 AT1G56145 1063 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G073391 [exp] 60 / 1e-11 AT1G29730 893 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036534 pacid=23174531 polypeptide=Lus10036534 locus=Lus10036534.g ID=Lus10036534.BGIv1.0 annot-version=v1.0 ATGTCCGAATTCGAGAGAGCTAATCTGATCTCGTGGGCTAGGCAGCTAGCTCACAACGGCAAGCTATTGGATCTCGTTGATCCTTTGATACATTCGTTGG ATAAACACCAAGCATTGCTTGTTATTACGATCGCATTGCTTTGCCTGCAGAGATCGCCTAGCAAGCGGCCGTCCATTAAGGAGATCGTGGAGATGCTCTC CGGCGAGGCCGATCCACCGCATTTGCCTTTCGAGTTTTCGCCCTCTCCGCCGTCCAATTTCCCGTTCAAGTCAAGGAAGAAAGCTCACCGGAAATCAGGA TTCTTCCACCATTACTTTCTCATCTGA
AA sequence Show only first row Show all	>Lus10036534 pacid=23174531 polypeptide=Lus10036534 locus=Lus10036534.g ID=Lus10036534.BGIv1.0 annot-version=v1.0 MSEFERANLISWARQLAHNGKLLDLVDPLIHSLDKHQALLVITIALLCLQRSPSKRPSIKEIVEMLSGEADPPHLPFEFSPSPPSNFPFKSRKKAHRKSG FFHHYFLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45590			Protein kinase superfamily pro...		Lus10036534 [exp]	0	1
AT2G45590			Protein kinase superfamily pro...		Lus10036533 [exp]	1.0	0.8447
AT1G15190			Fasciclin-like arabinogalactan...		Lus10015081 [exp]	4.9	0.8280
AT2G40815			Calcium-dependent lipid-bindin...		Lus10030501 [exp]	9.2	0.8071
AT3G13060		ECT5	evolutionarily conserved C-ter...		Lus10015778 [exp]	12.5	0.8139
AT4G04860		DER2.2	DERLIN-2.2 (.1)		Lus10018347 [exp]	13.4	0.7803
AT2G25920			unknown protein		Lus10001457 [exp]	18.0	0.7129
AT1G64450			Glycine-rich protein family (....		Lus10023071 [exp]	18.9	0.8123
AT4G26670			Mitochondrial import inner mem...		Lus10032577 [exp]	19.6	0.7533
AT2G32600			hydroxyproline-rich glycoprote...		Lus10021506 [exp]	20.6	0.7944
AT5G44170			S-adenosyl-L-methionine-depend...		Lus10039876 [exp]	21.4	0.7780

Compare expression of checked genes

Lus10036534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.