Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45630 115 / 3e-32 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT1G12550 107 / 3e-29 HPR3 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT1G79870 100 / 8e-27 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT5G28310 55 / 5e-10 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G14780 49 / 1e-07 FDH formate dehydrogenase (.1) AT4G34200 46 / 1e-06 EDA9 embryo sac development arrest 9, D-3-phosphoglycerate dehydrogenase (.1) AT1G68010 45 / 2e-06 ATHPR1, HPR hydroxypyruvate reductase (.1.2) AT3G19480 43 / 1e-05 D-3-phosphoglycerate dehydrogenase (.1) AT1G72190 43 / 1e-05 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT1G17745 40 / 0.0001 PGDH D-3-phosphoglycerate dehydrogenase (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041391 [exp] 187 / 1e-62 AT1G12550 131 / 3e-38 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10036537 [exp] 142 / 2e-42 AT2G45630 384 / 8e-134 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041393 [exp] 140 / 9e-42 AT2G45630 392 / 7e-137 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025796 [exp] 101 / 7e-27 AT1G79870 466 / 1e-166 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10011141 [exp] 96 / 9e-27 AT2G45630 139 / 2e-41 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10014133 [exp] 101 / 1e-26 AT1G12550 340 / 1e-116 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10006708 [exp] 100 / 2e-26 AT1G12550 358 / 4e-124 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10035866 [exp] 100 / 3e-26 AT1G79870 466 / 6e-167 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025795 [exp] 99 / 1e-25 AT1G79870 438 / 6e-156 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G073400 [exp] 131 / 7e-38 AT2G45630 405 / 2e-141 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073500 [exp] 127 / 1e-36 AT2G45630 377 / 4e-131 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151100 [exp] 125 / 7e-36 AT2G45630 400 / 3e-140 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G113250 [exp] 121 / 2e-34 AT1G12550 340 / 9e-117 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Potri.003G119000 [exp] 121 / 3e-34 AT2G45630 327 / 2e-111 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151200 [exp] 117 / 1e-32 AT2G45630 382 / 3e-133 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.003G052700 [exp] 100 / 3e-26 AT1G79870 443 / 7e-158 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G183700 [exp] 99 / 7e-26 AT1G79870 404 / 3e-142 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073600 [exp] 64 / 2e-14 AT2G45630 73 / 4e-17 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.013G104200 [exp] 50 / 3e-08 AT1G72190 466 / 1e-164 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF02826 [flax] [poplar] 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Representative CDS sequence Show only first row Show all	>Lus10036538 pacid=23174425 polypeptide=Lus10036538 locus=Lus10036538.g ID=Lus10036538.BGIv1.0 annot-version=v1.0 ATGGCGGCTGAATCCGACGTTCTAATCCTCTGCTGCGCGTTGACCGAGCTGACCAGACATACGGTCAACGCCCGGGGGATGGAGGCTCTGGGGAAGGAAG TAGTGATCATCAACGTGGCTCGAGGCGCGGTGGTTGATGAGGTGGAGCTCGTGCGGCGTTTGGTCGGAGGAGAGATGGCCGGCGCTGGATTGGACGTGTT TGAGAATGAGCCTGATGTTCCTGAGCAGCTGAAGGAGCTGGCGGACAAGGTTGTATTGAGCCCTCGTTGTGGGATTGCCAGCGTGGAGGCCATGGTGGAT TTGAGCCGCCTTGTTGTCGGGAATCTTGAGGCTTTCTTTTCCGGGCAGCCGTTGTTGTCTGAATACTTGGGCGATTGA
AA sequence Show only first row Show all	>Lus10036538 pacid=23174425 polypeptide=Lus10036538 locus=Lus10036538.g ID=Lus10036538.BGIv1.0 annot-version=v1.0 MAAESDVLILCCALTELTRHTVNARGMEALGKEVVIINVARGAVVDEVELVRRLVGGEMAGAGLDVFENEPDVPEQLKELADKVVLSPRCGIASVEAMVD LSRLVVGNLEAFFSGQPLLSEYLGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10036538 [exp]	0	1
AT5G06740			Concanavalin A-like lectin pro...		Lus10029291 [exp]	3.5	0.6662
AT4G08250	GRAS		GRAS family transcription fact...		Lus10020857 [exp]	18.8	0.6760
AT2G25180	GARP	ARR12	response regulator 12 (.1)		Lus10019058 [exp]	23.5	0.6789
AT1G54830	CCAAT	NF-YC3	"nuclear factor Y, subunit C3"...		Lus10008013 [exp]	41.0	0.5318
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	66.1	0.6082
AT4G12010			Disease resistance protein (TI...		Lus10008320 [exp]	99.7	0.5255
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10019633 [exp]	131.1	0.5234
AT5G18580		FASS2, TON2, GD...	GORDO, FASS 1, EMBRYO DEFECTIV...		Lus10002884 [exp]	183.1	0.5084

Compare expression of checked genes

Lus10036538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.